Protein Info for MPMX19_02967 in Azospirillum sp. SherDot2

Annotation: Efflux pump periplasmic linker BepF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 387 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 43 to 372 (330 residues), 281.6 bits, see alignment E=3.5e-88 PF00529: CusB_dom_1" amino acids 45 to 358 (314 residues), 30.3 bits, see alignment E=6.8e-11 PF13533: Biotin_lipoyl_2" amino acids 69 to 116 (48 residues), 51.5 bits, see alignment 1.4e-17 PF16576: HlyD_D23" amino acids 69 to 291 (223 residues), 45.5 bits, see alignment E=1.2e-15 PF13437: HlyD_3" amino acids 179 to 288 (110 residues), 27.2 bits, see alignment E=1.1e-09

Best Hits

KEGG orthology group: None (inferred from 96% identity to azl:AZL_b06260)

Predicted SEED Role

"RND efflux system, membrane fusion protein CmeA" in subsystem Multidrug Resistance Efflux Pumps or Multidrug efflux pump in Campylobacter jejuni (CmeABC operon)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (387 amino acids)

>MPMX19_02967 Efflux pump periplasmic linker BepF (Azospirillum sp. SherDot2)
MSRKTLSLLIAAGVSVAALTGAATLRSPAEAQTASPAPPPAEVDVATVLARPVTDWQSYS
GRLEAVDRVDIRPQVPGSIVAVHFRNGALVKQGDVLFTIDPRPYEAEVARAEAQVAAAQA
RVRFTVADLDRAQKLVRDDTISRSTMDQRDNAAREATANLKAAQAALDIARLNLGYTRVT
APVSGRVSRAERTVGNVVAAGATAEPLTTLVSESPIYASFDVDEQTYLRHIAPMRDSGTI
PVRLGLANEEDYSRSGMVEHVDNRLDSVSGTIRVRARFDNGDGTLVPGLYARVKVGGTKP
YDALLVDDRAIGTDQDKKFVLVVTAENKVEYRPVKLGTLQNGLRVVTAGLSAGEQVVVNG
MQHARPGMAVTPKTVAMGTEKTQTAAR