Protein Info for MPMX19_02951 in Azospirillum sp. SherDot2

Annotation: Deoxyribose-phosphate aldolase 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 72% identical to DEOC_RHORT: Deoxyribose-phosphate aldolase (deoC) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K01619, deoxyribose-phosphate aldolase [EC: 4.1.2.4] (inferred from 92% identity to azl:AZL_b05810)

MetaCyc: 52% identical to deoxyribose-phosphate aldolase (Yersinia sp. EA015)
Deoxyribose-phosphate aldolase. [EC: 4.1.2.4]

Predicted SEED Role

"Deoxyribose-phosphate aldolase (EC 4.1.2.4)" in subsystem Deoxyribose and Deoxynucleoside Catabolism (EC 4.1.2.4)

MetaCyc Pathways

superpathway of purine deoxyribonucleosides degradation (6/7 steps found)
2-deoxy-D-ribose degradation I (3/3 steps found)
superpathway of pyrimidine deoxyribonucleosides degradation (5/6 steps found)
2-deoxy-α-D-ribose 1-phosphate degradation (2/3 steps found)

KEGG Metabolic Maps

Pentose phosphate pathway

Isozymes

Compare fitness of predicted isozymes for: 4.1.2.4

Use Curated BLAST to search for 4.1.2.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (223 amino acids)

>MPMX19_02951 Deoxyribose-phosphate aldolase 1 (Azospirillum sp. SherDot2)
MPIPSVPAEPAGLAPFIDHTLLRPDAQPAEVERLCDEARAHAFKAVCVNPVFIPLVTERL
AGSPVAPCAVICFPFGADPSAIKADEAEWVVRHGAREVDMVIPIGLLKAGQVSAVRDDIA
EVRQACGDALLKVIIETSLLTDEEKILACRLSQEAGADFVKTSTGFAGGGATAEDVALMR
QTVGDGMGVKASGGVRTTEDARRMIAAGASRIGASASVAIIGG