Protein Info for MPMX19_02945 in Azospirillum sp. SherDot2

Annotation: Protein CbbX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 TIGR02880: CbbX protein" amino acids 21 to 304 (284 residues), 500.3 bits, see alignment E=7.6e-155 PF07728: AAA_5" amino acids 80 to 150 (71 residues), 28.1 bits, see alignment E=4.6e-10 PF00004: AAA" amino acids 81 to 211 (131 residues), 62.2 bits, see alignment E=1.9e-20 PF17866: AAA_lid_6" amino acids 237 to 298 (62 residues), 51.3 bits, see alignment E=2.4e-17

Best Hits

Swiss-Prot: 72% identical to CBBX_RHOSH: Protein CbbX (cbbX) from Rhodobacter sphaeroides

KEGG orthology group: None (inferred from 83% identity to rce:RC1_4064)

Predicted SEED Role

"probable RuBisCo-expression protein CbbX" in subsystem CO2 uptake, carboxysome

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (306 amino acids)

>MPMX19_02945 Protein CbbX (Azospirillum sp. SherDot2)
MSGAAGLLDQETRDRPSDAPSVDLDALYRESGIGGMLAGMDRDLIGLKPVKTRIREIAAL
LLVERARRSIGLRAEPPSLHMCFTGNPGTGKTSVARRMAGLLHGLGYIRRDHVVSVTRDD
LVGQYIGHTAPKTKEVLKRAMGGVLFIDEAYYLYRPENERDYGQEAIEILLQVMEDSRDD
LVVILAGYRDRMEVFFRSNPGMASRIAHHVDFPDYEAEELLEIARLMTAGMQYRLAPEAE
RAMADYILRRMVQPRFANARSIRNALDRARLRQANRLFEARGSAIAADDLLTIAEEDIRQ
SRVFTQ