Protein Info for MPMX19_02941 in Azospirillum sp. SherDot2

Annotation: Fructose-bisphosphate aldolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00167: ketose-bisphosphate aldolase
  • amino acids 1 to 328 (328 residues), 311.5 bits, E=5.8e-97
• TIGR01521: fructose-bisphosphate aldolase, class II, Calvin cycle subtype
  • amino acids 3 to 346 (344 residues), 599 bits, E=2.8e-184
• PF01116: F_bP_aldolase
  • amino acids 5 to 327 (323 residues), 316.5 bits, E=9e-99

Best Hits

Swiss-Prot: 76% identical to ALF1_CUPNH: Fructose-bisphosphate aldolase, chromosomal (cbbAC) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)

KEGG orthology group: K01624, fructose-bisphosphate aldolase, class II [EC: 4.1.2.13] (inferred from 80% identity to rce:RC1_4068)

MetaCyc: 62% identical to class II fructose-bisphosphate aldolase/sedoheptulose-1,7-bisphosphate aldolase monomer (Synechocystis sp. PCC 6803)
Fructose-bisphosphate aldolase. [EC: 4.1.2.13]; 4.1.2.13 [EC: 4.1.2.13]

Predicted SEED Role

"Fructose-bisphosphate aldolase class II (EC 4.1.2.13)" in subsystem Calvin-Benson cycle or Glycolysis and Gluconeogenesis (EC 4.1.2.13)

MetaCyc Pathways

• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (23/26 steps found)
• homolactic fermentation (12/12 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (19/22 steps found)
• glycolysis III (from glucose) (11/11 steps found)
• superpathway of glycolysis and the Entner-Doudoroff pathway (15/17 steps found)
• Calvin-Benson-Bassham cycle (12/13 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (16/19 steps found)
• superpathway of anaerobic sucrose degradation (16/19 steps found)
• glycolysis II (from fructose 6-phosphate) (10/11 steps found)
• ethene biosynthesis V (engineered) (20/25 steps found)
• glycolysis I (from glucose 6-phosphate) (11/13 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (21/27 steps found)
• formaldehyde assimilation III (dihydroxyacetone cycle) (10/12 steps found)
• gluconeogenesis III (10/12 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (20/26 steps found)
• superpathway of N-acetylneuraminate degradation (17/22 steps found)
• glycolysis IV (8/10 steps found)
• oxygenic photosynthesis (13/17 steps found)
• pentose phosphate pathway (non-oxidative branch) II (5/6 steps found)
• gluconeogenesis I (10/13 steps found)
• sedoheptulose bisphosphate bypass (2/2 steps found)
• formaldehyde assimilation II (assimilatory RuMP Cycle) (7/9 steps found)
• sucrose biosynthesis I (from photosynthesis) (7/9 steps found)
• glycolysis VI (from fructose) (8/11 steps found)
• superpathway of hexitol degradation (bacteria) (12/18 steps found)
• glycolysis V (Pyrococcus) (6/10 steps found)
• 1,3-propanediol biosynthesis (engineered) (5/9 steps found)
• sucrose degradation V (sucrose α-glucosidase) (2/5 steps found)
• gluconeogenesis II (Methanobacterium thermoautotrophicum) (11/18 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (21/56 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Carbon fixation in photosynthetic organisms
• Fructose and mannose metabolism
• Glycolysis / Gluconeogenesis
• Pentose phosphate pathway

Isozymes

Compare fitness of predicted isozymes for: 4.1.2.13

Use Curated BLAST to search for 4.1.2.13

Protein Sequence (363 amino acids)

>MPMX19_02941 Fructose-bisphosphate aldolase (Azospirillum sp. SherDot2)
MALISLRQLLDHAAQHGYGVPAFNINNMEQIQAIMQAADDCASPVILQASAGARKYAGEP
FLRHMVQAAAEMWPHIPVCLHQDHGASPAVCQQAIRSGFTSVMMDGSLLDDMKTPAGYDY
NIRVTRQVVEQAHAVGVSVEGELGCLGSLETGKAGEEDGSGAAGTLSRDQLLTDPEQAAD
FVARTGVDALAIAIGTSHGAYKFSRRPDGEVLAIGRIRAIHERIPDTHLVMHGSSSVPQE
WLEIIRAHGGCIRETYGVPVEEIREGIRNGVRKVNIDTDIRLAMSGSLRRALMTRPEEFD
PRRFLAEATRAARSLCRERFEAFGSAGHAERIVPLPLERMAARSAALEFAAMERRSPTVM
ASH