Protein Info for MPMX19_02889 in Azospirillum sp. SherDot2

Annotation: Galactarate dehydratase (L-threo-forming)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 507 TIGR03248: galactarate dehydratase" amino acids 6 to 507 (502 residues), 931.1 bits, see alignment E=7.2e-285 PF08666: SAF" amino acids 14 to 83 (70 residues), 25.5 bits, see alignment E=2.4e-09 PF04295: GD_AH_second" amino acids 114 to 254 (141 residues), 120.7 bits, see alignment E=7.3e-39 PF20629: GD_AH_C" amino acids 264 to 501 (238 residues), 308.2 bits, see alignment E=5.7e-96

Best Hits

Swiss-Prot: 72% identical to GARD_BACSU: Probable galactarate dehydratase (L-threo-forming) (garD) from Bacillus subtilis (strain 168)

KEGG orthology group: K01708, galactarate dehydratase [EC: 4.2.1.42] (inferred from 94% identity to azl:AZL_b02810)

MetaCyc: 68% identical to GarD (Escherichia coli K-12 substr. MG1655)
Galactarate dehydratase. [EC: 4.2.1.42]

Predicted SEED Role

"D-galactarate dehydratase (EC 4.2.1.42)" in subsystem D-Galacturonate and D-Glucuronate Utilization or D-galactarate, D-glucarate and D-glycerate catabolism (EC 4.2.1.42)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.42

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (507 amino acids)

>MPMX19_02889 Galactarate dehydratase (L-threo-forming) (Azospirillum sp. SherDot2)
MTQKPLYILVHPEDNVAIVVNSGGLPPGTEFECGLVLTDFVPQGHKVALADLDEGASIIR
YGQVIGTAARPVRRGAWIEESLVRLPQAPDLDTLPLATAVPPDAPALDGYTFEGYRNPDG
TVGTKNVLGISISVQCVAGVMDFAIERIKKELLPKYPNVDDVVALNHTYGCGVAINAPGA
AVPIRTLQNLARNPNLGGAVMVVGLGCEKLQPERLLPAGVEPSIVTLQDERHQGFGDMVA
SILEMADRRLSQLNERRRETCPASDLVVGLQCGGSDAFSGVTANPALGYAADLLVRAGAT
VMFSEVTEVRDAIHLLTPRAIDEETGRALIREMRWYDDYLETGSADRSANPTPGNKKGGL
ANVVEKALGSIAKSGTSPIAGVLSPGERATRKGLLYAATPASDFICGTLQLASGCNIEVF
TTGRGTPYGLAMAPVIKVATRTELASRWHDLIDVDAGRIATGDATIEDVGWELFRLILEV
ASGRKQTWADHWGLRNTLTLFNPAPVT