Protein Info for MPMX19_02882 in Azospirillum sp. SherDot2

Annotation: Threonine/homoserine exporter RhtA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 296 signal peptide" amino acids 1 to 36 (36 residues), see Phobius details transmembrane" amino acids 48 to 66 (19 residues), see Phobius details amino acids 78 to 96 (19 residues), see Phobius details amino acids 102 to 122 (21 residues), see Phobius details amino acids 129 to 145 (17 residues), see Phobius details amino acids 151 to 173 (23 residues), see Phobius details amino acids 185 to 203 (19 residues), see Phobius details amino acids 209 to 232 (24 residues), see Phobius details amino acids 244 to 264 (21 residues), see Phobius details amino acids 270 to 289 (20 residues), see Phobius details PF00892: EamA" amino acids 156 to 284 (129 residues), 63.7 bits, see alignment E=1.2e-21

Best Hits

Swiss-Prot: 49% identical to RHTA_SALTS: Threonine/homoserine exporter RhtA (rhtA) from Salmonella typhimurium (strain SL1344)

KEGG orthology group: None (inferred from 88% identity to azl:AZL_b02870)

MetaCyc: 48% identical to L-threonine/L-homoserine exporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-242; TRANS-RXN0-0244

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (296 amino acids)

>MPMX19_02882 Threonine/homoserine exporter RhtA (Azospirillum sp. SherDot2)
MANASIETSAATRPEPAALPLLLLLASLLSQYVGAASAKSLFPLVGAEGVTGLRVGLSAL
MLMAILRPWRSLPGRGDLRNLLVYGATLGAMNLSIYRAMELIPIGIAIAIEVTGPLAVAL
LGSRRLKDFLWIACAAVGLVLLLPLREASSALNPVGVAYAAAAAFCWALYIVFGKRASAL
PGGQAVAWGMLVAASFTVPLGISHAGAGLLVPAVLFTGLAVAVLSSMVPYLLEMMALRRL
PSHVFGLAVSASPAVAALIGFLMLGERLSAVQWAAIACIMCASAGSALGKARRGRE