Protein Info for MPMX19_02876 in Azospirillum sp. SherDot2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 364 transmembrane" amino acids 23 to 42 (20 residues), see Phobius details amino acids 52 to 71 (20 residues), see Phobius details amino acids 84 to 106 (23 residues), see Phobius details amino acids 112 to 133 (22 residues), see Phobius details amino acids 141 to 163 (23 residues), see Phobius details amino acids 171 to 193 (23 residues), see Phobius details amino acids 202 to 224 (23 residues), see Phobius details amino acids 236 to 256 (21 residues), see Phobius details amino acids 277 to 297 (21 residues), see Phobius details amino acids 305 to 327 (23 residues), see Phobius details amino acids 339 to 361 (23 residues), see Phobius details PF03601: Cons_hypoth698" amino acids 26 to 339 (314 residues), 198.9 bits, see alignment E=4.9e-63

Best Hits

KEGG orthology group: None (inferred from 87% identity to azl:AZL_b02910)

Predicted SEED Role

"Putative membrane protein YeiH" in subsystem YeiH

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (364 amino acids)

>MPMX19_02876 hypothetical protein (Azospirillum sp. SherDot2)
MIPDTAAPAKAVPGKPMLFQIRSLLPGLALCVAVTALAFAVARAEVALFGEAWIEALVLA
ILIGTTFRTAWAPSASWQPGIAFSAKILLEVAVVLLGASVSAATILSAGPALLLGIAGVV
ALALLAGFGIGRLLGLPVRMAVLVACGNAICGNSAIAAVAPVIDAHSDDVAASIAFTAVL
GVAVVLGLPLLGIGLRLSGVQYGALAGLTVYAVPQVIAAAAPLGATAVQVGTLVKLVRVL
MLGPVCLLLSLLAPRLGGDSVGADAGAPRRGRPRPPVHHLVPWFIQGFLAMIALRSFDLI
PHTALLAMEHAATLLTVVSMAALGLGVDVRTVARAGGRVTAAVVLSLLALGTISLTLIRL
IGLT