Protein Info for MPMX19_02862 in Azospirillum sp. SherDot2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 145 transmembrane" amino acids 6 to 29 (24 residues), see Phobius details amino acids 39 to 59 (21 residues), see Phobius details amino acids 71 to 90 (20 residues), see Phobius details amino acids 102 to 120 (19 residues), see Phobius details amino acids 126 to 144 (19 residues), see Phobius details PF00892: EamA" amino acids 8 to 143 (136 residues), 85.8 bits, see alignment E=3.5e-28 PF05653: Mg_trans_NIPA" amino acids 77 to 142 (66 residues), 27.9 bits, see alignment E=1.4e-10

Best Hits

Swiss-Prot: 71% identical to YCB6_SINSX: Uncharacterized transporter in cobO 3'region from Sinorhizobium sp.

KEGG orthology group: K08978, putative membrane protein (inferred from 92% identity to azl:AZL_b03000)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (145 amino acids)

>MPMX19_02862 hypothetical protein (Azospirillum sp. SherDot2)
MTGDLFPSWMLWALLSACFAALTAVFAKVGVEGVGSDMATLIRTAVIFAMLIGIVVSSGQ
SLSPSAVSGRTWLFLVLSGLATGASWLCYFRALKLGPASQVAPVDKLSVVLVAVFGVLFL
GEKLSAPNWLGVVLIAAGVILLAFK