Protein Info for MPMX19_02797 in Azospirillum sp. SherDot2

Annotation: 2,3-dimethylmalate lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 286 PF13714: PEP_mutase" amino acids 15 to 222 (208 residues), 149.6 bits, see alignment E=1.2e-47 PF00463: ICL" amino acids 77 to 158 (82 residues), 29 bits, see alignment E=4.1e-11

Best Hits

Predicted SEED Role

"Methylisocitrate lyase (EC 4.1.3.30)" in subsystem Methylcitrate cycle or Propionate-CoA to Succinate Module (EC 4.1.3.30)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.3.30

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (286 amino acids)

>MPMX19_02797 2,3-dimethylmalate lyase (Azospirillum sp. SherDot2)
MSRGPEFRNRILAQKTVWSAGAYDALSARFIEAAGFDALMTSGFGVSASFLGQPDAELYT
MSENLTVVRNVVSAVNVPVIADIDTGYGNAINVMRTIREFEASGVSAVIMEDQVAPKRCP
ICVGGVEVIPMDEAVAKIEAAVAARRDPNMLIIARTDVVDPAAAMERGRAYVAAGADMIQ
PISKCFQNIDGLRAMREAVGVPLSLQLLGWLEKLSADEVEEVAGMATYALVPLMTVASAL
KENLAALAERRSTRDLPRPVTDHNSFIDFIGFPQIEELQKRYLKTA