Protein Info for MPMX19_02773 in Azospirillum sp. SherDot2

Annotation: Gamma-glutamylputrescine oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 447 PF01266: DAO" amino acids 50 to 402 (353 residues), 190.4 bits, see alignment E=1.1e-59 PF00890: FAD_binding_2" amino acids 50 to 94 (45 residues), 30.7 bits, see alignment 3e-11

Best Hits

KEGG orthology group: None (inferred from 60% identity to rpb:RPB_1037)

Predicted SEED Role

"L-pipecolate oxidase (1.5.3.7)" in subsystem Lysine degradation

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (447 amino acids)

>MPMX19_02773 Gamma-glutamylputrescine oxidoreductase (Azospirillum sp. SherDot2)
MTNQGAHQGAGQAQDIPGRGGIWQRPDSLWEATAPPPPVLPTLQDSVQADVLVIGGGFTG
LSAGLHAAEAGRRVVLLEASELGRGASGRNNGQVIPTLTRPDPADLIDRFGWESGERLVG
LIRDSASTLFDLVRRLGIDCAAEQTGWVQPVHSPGRIKIAERRATQWGKFGADVELLDRA
AVSAILGTDAYFGGWMNRTGGHINPLALVRGLAAKVVAAGAAVYVNSPALSVQRRGDSWV
ARTPQGMVTAGSLVLGTNGYAASIFPEIRTEVVPVLSWQMATAPLGDNVRKTVLPGRQAM
SDTHGDLRFMRYTADNRLVTGGALLNPVNGAERLKRIVGARLAGMFPALNGVGFDYVWNG
RIAMTTDYFPRVHRLGPNGFAWAGCNGRGVALSVSLGRELARAAIGQDPKDLALPFTAPT
PLPFNALLQRIGPLKILQYRWNDAREV