Protein Info for MPMX19_02748 in Azospirillum sp. SherDot2

Annotation: L-lactate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00056: Ldh_1_N
  • amino acids 1 to 139 (139 residues), 135.7 bits, E=1.2e-43
• TIGR01771: L-lactate dehydrogenase
  • amino acids 5 to 303 (299 residues), 352.1 bits, E=1.3e-109
• PF02866: Ldh_1_C
  • amino acids 142 to 306 (165 residues), 101.1 bits, E=7.2e-33

Best Hits

Swiss-Prot: 67% identical to LDH_THET2: L-lactate dehydrogenase (ldh) from Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039)

KEGG orthology group: K00016, L-lactate dehydrogenase [EC: 1.1.1.27] (inferred from 94% identity to azl:AZL_026880)

Predicted SEED Role

"L-lactate dehydrogenase (EC 1.1.1.27)" in subsystem Fermentations: Lactate or Fermentations: Mixed acid (EC 1.1.1.27)

MetaCyc Pathways

• homolactic fermentation (12/12 steps found)
• superpathway of glucose and xylose degradation (15/17 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (16/19 steps found)
• superpathway of anaerobic sucrose degradation (16/19 steps found)
• Bifidobacterium shunt (13/15 steps found)
• heterolactic fermentation (15/18 steps found)
• pyruvate fermentation to acetate and (S)-lactate I (4/4 steps found)
• pyruvate fermentation to acetate and lactate II (4/4 steps found)
• pyruvate fermentation to (S)-lactate (1/1 steps found)
• methylglyoxal degradation V (2/3 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (9/13 steps found)
• L-histidine degradation V (1/2 steps found)
• lactate fermentation to acetate, CO₂ and hydrogen (Desulfovibrionales) (4/8 steps found)

KEGG Metabolic Maps

• Cysteine metabolism
• Glycolysis / Gluconeogenesis
• Propanoate metabolism
• Pyruvate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.27

Protein Sequence (316 amino acids)

>MPMX19_02748 L-lactate dehydrogenase (Azospirillum sp. SherDot2)
MKVGIVGAGFVGSTAAFAMVTTGAASEVVLVDMNEALAQAQAQDIAHAVPFTHAVTVRAG
SYAALEGAGVVVLSAGVAQKPGETRLELLERNAKVFGAIIPEVLKAAPDAVLLVASNPVD
VMTQIATRISGLPRNRVIGSGTVLDTARFRALLAEQLAVTPRSVHAHVVGEHGDSEVLLW
SSATVAGLSVEQAAAQLRRSLTADDRAAIDEGVRRAAYRIINGKGHTAFGIGGGLARLVA
AIGADERMVATCAMLTDDVCGVPQLVLSLPRVIGAGGVVDTILPNLSAEEETALRRSAEI
LKEAADGVERRMGWSS