Protein Info for MPMX19_02748 in Azospirillum sp. SherDot2

Annotation: L-lactate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 316 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF00056: Ldh_1_N" amino acids 1 to 139 (139 residues), 135.7 bits, see alignment E=1.2e-43 TIGR01771: L-lactate dehydrogenase" amino acids 5 to 303 (299 residues), 352.1 bits, see alignment E=1.3e-109 PF02866: Ldh_1_C" amino acids 142 to 306 (165 residues), 101.1 bits, see alignment E=7.2e-33

Best Hits

Swiss-Prot: 67% identical to LDH_THET2: L-lactate dehydrogenase (ldh) from Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039)

KEGG orthology group: K00016, L-lactate dehydrogenase [EC: 1.1.1.27] (inferred from 94% identity to azl:AZL_026880)

Predicted SEED Role

"L-lactate dehydrogenase (EC 1.1.1.27)" in subsystem Fermentations: Lactate or Fermentations: Mixed acid (EC 1.1.1.27)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (316 amino acids)

>MPMX19_02748 L-lactate dehydrogenase (Azospirillum sp. SherDot2)
MKVGIVGAGFVGSTAAFAMVTTGAASEVVLVDMNEALAQAQAQDIAHAVPFTHAVTVRAG
SYAALEGAGVVVLSAGVAQKPGETRLELLERNAKVFGAIIPEVLKAAPDAVLLVASNPVD
VMTQIATRISGLPRNRVIGSGTVLDTARFRALLAEQLAVTPRSVHAHVVGEHGDSEVLLW
SSATVAGLSVEQAAAQLRRSLTADDRAAIDEGVRRAAYRIINGKGHTAFGIGGGLARLVA
AIGADERMVATCAMLTDDVCGVPQLVLSLPRVIGAGGVVDTILPNLSAEEETALRRSAEI
LKEAADGVERRMGWSS