Protein Info for MPMX19_02738 in Azospirillum sp. SherDot2

Annotation: Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta, chloroplastic

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00515: acetyl-CoA carboxylase, carboxyl transferase, beta subunit
  • amino acids 15 to 280 (266 residues), 360.3 bits, E=3.7e-112
• PF17848: Zn_ribbon_ACC
  • amino acids 26 to 51 (26 residues), 40.7 bits, see alignment (E = 2.1e-14)
• PF01039: Carboxyl_trans
  • amino acids 93 to 241 (149 residues), 75.9 bits, E=2.8e-25

Best Hits

Swiss-Prot: 65% identical to ACCD_GRABC: Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta (accD) from Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1)

KEGG orthology group: K01963, acetyl-CoA carboxylase carboxyl transferase subunit beta [EC: 6.4.1.2] (inferred from 93% identity to azl:AZL_027060)

Predicted SEED Role

"Acetyl-coenzyme A carboxyl transferase beta chain (EC 6.4.1.2)" in subsystem Fatty Acid Biosynthesis FASII (EC 6.4.1.2)

MetaCyc Pathways

• propanoyl CoA degradation I (3/3 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (13/17 steps found)
• 2-oxobutanoate degradation I (3/4 steps found)
• anaerobic energy metabolism (invertebrates, mitochondrial) (7/10 steps found)
• fatty acid biosynthesis initiation (type I) (1/3 steps found)
• methylaspartate cycle (12/19 steps found)
• 3-hydroxypropanoate cycle (7/13 steps found)
• superpathway of L-methionine salvage and degradation (9/16 steps found)
• 3-hydroxypropanoate/4-hydroxybutanate cycle (10/18 steps found)
• jadomycin biosynthesis (3/9 steps found)
• superpathway of the 3-hydroxypropanoate cycle (8/18 steps found)
• superpathway of mycolate biosynthesis (27/239 steps found)

KEGG Metabolic Maps

• Fatty acid biosynthesis
• Propanoate metabolism
• Pyruvate metabolism
• Tetracycline biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 6.4.1.2

Use Curated BLAST to search for 6.4.1.2

Protein Sequence (348 amino acids)

>MPMX19_02738 Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta, chloroplastic (Azospirillum sp. SherDot2)
MNWLTNYVRPKIRALYARKEVPDNLWHKCPSCESMLFHRELEDNLHVCQHCGFHMRLGPV
KRLETMFDDGAYEGVELPKSVADPLKFRDQKRYTDRLKEAQTKTGRTDAIVVGEGRIGGH
AAVVAAFDFGFMGGSMGIAVGEGLLTAARLAVAKNAPLIVVPASGGARMQEGILSLMQMP
RTTIAVEMVKEAGLPYIVVLTDPTTGGVTASFAMLGDIHIAEKGAQIGFAGARVIESTIR
ETLPEGFQRSEYLLEHGMVDMVVHRRDLRPTLVRTIGLLMTPRIDAVVEDLDLTAAQGAV
QGVGGEPAQLPQGAVAQPGTPQPGLPPATQATAAQPASTAEPVQAGDD