Protein Info for MPMX19_02731 in Azospirillum sp. SherDot2

Annotation: Deoxyuridine 5'-triphosphate nucleotidohydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 155 TIGR00576: dUTP diphosphatase" amino acids 17 to 153 (137 residues), 166.9 bits, see alignment E=1.1e-53 PF00692: dUTPase" amino acids 20 to 153 (134 residues), 93 bits, see alignment E=1.3e-30 PF22769: DCD" amino acids 39 to 127 (89 residues), 34.2 bits, see alignment E=2.7e-12

Best Hits

Swiss-Prot: 69% identical to DUT_CAUVN: Deoxyuridine 5'-triphosphate nucleotidohydrolase (dut) from Caulobacter vibrioides (strain NA1000 / CB15N)

KEGG orthology group: K01520, dUTP pyrophosphatase [EC: 3.6.1.23] (inferred from 89% identity to azl:AZL_027130)

Predicted SEED Role

"Deoxyuridine 5'-triphosphate nucleotidohydrolase (EC 3.6.1.23)" in subsystem Nudix proteins (nucleoside triphosphate hydrolases) (EC 3.6.1.23)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.23

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (155 amino acids)

>MPMX19_02731 Deoxyuridine 5'-triphosphate nucleotidohydrolase (Azospirillum sp. SherDot2)
MSSTLSPTVAFLRLPGNDDLPLPSYATDGAAGFDLRAAVPADAPVTLEPGKRVLVPTGFA
VGLPAGWEMQIRPRSGLAVENGVTVLNTPGTVDCDYRGPVGVCLINLGEESFAIARGDRV
AQAVIAEAPRAVLVEVASLDETARGAGGFGSTGVA