Protein Info for MPMX19_02726 in Azospirillum sp. SherDot2

Annotation: tRNA threonylcarbamoyladenosine biosynthesis protein TsaE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00150: tRNA threonylcarbamoyl adenosine modification protein YjeE
  • amino acids 13 to 145 (133 residues), 95.4 bits, E=1.3e-31
• PF02367: TsaE
  • amino acids 14 to 139 (126 residues), 125 bits, E=9.4e-41

Best Hits

Swiss-Prot: 40% identical to TSAE_SHIFL: tRNA threonylcarbamoyladenosine biosynthesis protein TsaE (tsaE) from Shigella flexneri

KEGG orthology group: K06925, UPF0079 ATP-binding protein (inferred from 92% identity to azl:AZL_027170)

MetaCyc: 40% identical to N6-L-threonylcarbamoyladenine synthase, TsaE subunit (Escherichia coli K-12 substr. MG1655)
RXN-14570 [EC: 2.3.1.234]

Predicted SEED Role

"TsaE protein, required for threonylcarbamoyladenosine t(6)A37 formation in tRNA"

MetaCyc Pathways

• N⁶-L-threonylcarbamoyladenosine³⁷-modified tRNA biosynthesis (1/2 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.234

Protein Sequence (160 amino acids)

>MPMX19_02726 tRNA threonylcarbamoyladenosine biosynthesis protein TsaE (Azospirillum sp. SherDot2)
MPDTPLHTVTLPLPDEAATAALGRRLGVLLRPGDLVALRGDLGAGKSALSRALIRSVTHE
DAEVPSPTFTLVQTYDTAIGPVWHFDLYRLSGPDEVYELGWDDARAEAVALVEWPDRLGP
LLPPDRVEVTMEHDGPDARRATLTGHGALAARVAAADWTL