Protein Info for MPMX19_02693 in Azospirillum sp. SherDot2

Annotation: RecBCD enzyme subunit RecB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 691 PF00580: UvrD-helicase" amino acids 42 to 301 (260 residues), 68.6 bits, see alignment E=7.2e-23 PF13245: AAA_19" amino acids 42 to 302 (261 residues), 31 bits, see alignment E=2.7e-11

Best Hits

Predicted SEED Role

"ATP-dependent DNA helicase UvrD/PcrA" in subsystem DNA repair, bacterial UvrD and related helicases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (691 amino acids)

>MPMX19_02693 RecBCD enzyme subunit RecB (Azospirillum sp. SherDot2)
MSEFFSLPVINDADIFWIEEALGLRFAGERRDVLQALDSGDVEACPGSGKTTLLVAKLAI
LARKWTARSRGICVLSYTTVARDELEKGVQRVPEAARLLTYPHYVGTIHGFVNSFLALPY
LRSYHMGPIGVRFIDDDRCRAVARRIVWEDDRFEPIRKFAIMRAQSSSRKATAGAPKKTA
MEVVSELCDALEYRGAELGLDLSAFQLKDPKLPTYEAMTELRRRLRRLGYFFHNDMFAFG
ERLVAEAPQYPALIRHRFPCVFMDEMQDTQPLHAAMLSRLFPKDACALRQRFGDSDQAIY
DGDRGEPEAVPVVDAFPDAQARSLPRSNRFGGWIAARASAVAPSRRVMEGDALHRWGTLR
GEPTSSRGHTIFLFGPEAMHERPLQAFGALLCREFDGDTLHHGVFTAIGRVHAPPGQRAR
KADQLPHSVRDYWNRYEPDTSRRTARPRVLADYLCLAHHRRTESGELGPAITELALGLIH
LLEACGAPEFGTRHNPLRQLRAYASERPALWLAIHKWLWDCATMSTPPNPATWPVIRVAT
EALVRSHQEGGWHRSRQMEPIDAFLAWPEEAIVRAPEQPPRHLYVHQGEDGRSVNIRLGS
IHSVKGQTHTATLILDTFFHSCHIGRHFRLLAGRKSPMALDAQRLLYVAMTRPSHLLCVA
LRASHLGEGKAALGWERRLQDVGWRIEHIAP