Protein Info for MPMX19_02673 in Azospirillum sp. SherDot2

Annotation: Aspartokinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00696: AA_kinase
  • amino acids 3 to 229 (227 residues), 178.2 bits, E=5.8e-56
• TIGR00656: aspartate kinase, monofunctional class
  • amino acids 4 to 407 (404 residues), 431.5 bits, E=3.5e-133
• TIGR00657: aspartate kinase
  • amino acids 56 to 406 (351 residues), 383.4 bits, E=1.7e-118
• PF22468: ACT_9
  • amino acids 269 to 330 (62 residues), 46.1 bits, E=8.6e-16
  • amino acids 348 to 405 (58 residues), 85.5 bits, E=4.2e-28
• PF01842: ACT
  • amino acids 270 to 329 (60 residues), 48.9 bits, E=1.1e-16
• PF13840: ACT_7
  • amino acids 341 to 403 (63 residues), 60.2 bits, E=3.6e-20

Best Hits

Swiss-Prot: 58% identical to AK_PSEAE: Aspartokinase (lysC) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00928, aspartate kinase [EC: 2.7.2.4] (inferred from 98% identity to azl:AZL_001140)

MetaCyc: 56% identical to aspartokinase (Halomonas elongata DSM 2581)
Aspartate kinase. [EC: 2.7.2.4]

Predicted SEED Role

"Aspartokinase (EC 2.7.2.4)" in subsystem Lysine Biosynthesis DAP Pathway or Threonine and Homoserine Biosynthesis (EC 2.7.2.4)

MetaCyc Pathways

• aspartate superpathway (23/25 steps found)
• superpathway of L-isoleucine biosynthesis I (13/13 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (16/18 steps found)
• L-lysine biosynthesis I (9/9 steps found)
• superpathway of L-methionine biosynthesis (by sulfhydrylation) (11/12 steps found)
• superpathway of L-threonine biosynthesis (6/6 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (12/15 steps found)
• L-lysine biosynthesis III (6/7 steps found)
• L-lysine biosynthesis VI (6/7 steps found)
• L-homoserine biosynthesis (3/3 steps found)
• L-lysine biosynthesis II (7/9 steps found)
• superpathway of S-adenosyl-L-methionine biosynthesis (7/9 steps found)
• superpathway of L-methionine biosynthesis (transsulfuration) (7/9 steps found)
• superpathway of L-homoserine and L-methionine biosynthesis (6/8 steps found)
• dipicolinate biosynthesis (3/4 steps found)
• chorismate biosynthesis II (archaea) (8/12 steps found)
• L-methionine biosynthesis IV (2/4 steps found)
• spermidine biosynthesis II (2/4 steps found)
• ectoine biosynthesis (2/5 steps found)
• 3-dehydroquinate biosynthesis II (archaea) (3/7 steps found)
• norspermidine biosynthesis (2/6 steps found)
• cremeomycin biosynthesis (2/7 steps found)
• grixazone biosynthesis (2/8 steps found)
• superpathway of polyamine biosynthesis III (2/8 steps found)
• platensimycin biosynthesis (6/26 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of plant hormones
• Glycine, serine and threonine metabolism
• Lysine biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.2.4

Protein Sequence (411 amino acids)

>MPMX19_02673 Aspartokinase (Azospirillum sp. SherDot2)
MARIVLKFGGTSVGDIDRIKNVARKVEQEVKAGHQVAVVVSAMSGVTNQLVKYCNEIDKL
HDAREYDAVVASGEQVTSGLLAVALQSLGIPARSWAGWQIPIRTDDTHGKARIVSIDTTE
MEKSLQTGEVAVVAGFQGVSEHGRITTLGRGGSDTSAVALAAAVKADRCDIYTDVDGVYT
TDPRIVTKARKLDKITYEEMLEMASQGAKVLQTRSVEMAMNHRVRVQVLSSFEAAAGSSL
PGTLVVDEDEIVEKEVVSGIAYSRDEAKITLVGVADQPGVAAAIFGPLTDNAVNVDMIVQ
NVSEDGKSTDMTFTVGKADIARAVKVLEDAQSTLNYKRIISDANVVKVSVIGVGMRSHAG
VAQRMFKALADKGINIQVISTSEIKISVLIAEEYAELALRALHTAYGLDAA