Protein Info for MPMX19_02664 in Azospirillum sp. SherDot2

Annotation: Arabinose 5-phosphate isomerase KdsD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 347 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details TIGR00393: sugar isomerase, KpsF/GutQ family" amino acids 72 to 337 (266 residues), 305.5 bits, see alignment E=1.8e-95 PF01380: SIS" amino acids 72 to 199 (128 residues), 99.8 bits, see alignment E=1.1e-32 PF00571: CBS" amino acids 227 to 283 (57 residues), 33.2 bits, see alignment E=5.3e-12 amino acids 294 to 344 (51 residues), 41.1 bits, see alignment 1.8e-14

Best Hits

Swiss-Prot: 44% identical to Y505_RICPR: Uncharacterized protein RP505 (RP505) from Rickettsia prowazekii (strain Madrid E)

KEGG orthology group: K06041, arabinose-5-phosphate isomerase [EC: 5.3.1.13] (inferred from 93% identity to azl:AZL_001050)

Predicted SEED Role

"Arabinose 5-phosphate isomerase (EC 5.3.1.13)" in subsystem KDO2-Lipid A biosynthesis (EC 5.3.1.13)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.1.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (347 amino acids)

>MPMX19_02664 Arabinose 5-phosphate isomerase KdsD (Azospirillum sp. SherDot2)
MTSVITSSLSGSLTDGAASTGSTLAGSSPVENRDLACATRVLRTEADALLALAGSLDGKF
LRALDILQGIEGRVIVTGMGKSGHVARKIAATMASTGTPAFFVHPGEASHGDLGMIAKID
AVVALSNSGETHELADIIAYTRRFGIPLIGMTRRAASSLAEQSDVALVIPPEPEACPLGL
APTTSTTMMLALGDALAVALLERRGFSAADFREFHPGGQLGRALLKVTDIMHKGEDLPLC
RLDSPLSDVIFEMTAKRLGCVGVTDDAGALVGIITDGDLRRHLTPELLAERADSIMSPRP
KTIRPKALIVEALREMNDKKITTLFVIEADRPLGIVHIHDVLRAGAA