Protein Info for MPMX19_02649 in Azospirillum sp. SherDot2

Annotation: Putative low molecular weight protein-tyrosine-phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 168 PF01451: LMWPc" amino acids 7 to 152 (146 residues), 140.7 bits, see alignment E=2.2e-45

Best Hits

Swiss-Prot: 40% identical to YFKJ_BACSU: Low molecular weight protein-tyrosine-phosphatase YfkJ (yfkJ) from Bacillus subtilis (strain 168)

KEGG orthology group: K01104, protein-tyrosine phosphatase [EC: 3.1.3.48] (inferred from 84% identity to azl:AZL_000930)

Predicted SEED Role

"Low molecular weight protein tyrosine phosphatase (EC 3.1.3.48)" in subsystem LMPTP YfkJ cluster or LMPTP YwlE cluster (EC 3.1.3.48)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.48

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (168 amino acids)

>MPMX19_02649 Putative low molecular weight protein-tyrosine-phosphatase (Azospirillum sp. SherDot2)
MPGVLKVLFVCTGNICRSPTAEGVFRHLAERAGLGALVSADSAGTHGYHVGEPPDPRTVR
AALARGVDLSALRARKVVADDFTRFDHILAMDHGHLAQLRRIAPAGATAALRLFLDDAAG
VEGREVPDPYYGGPDGFEQVLDLCEAGSRGLLDRLSRESRFPIRESLG