Protein Info for MPMX19_02639 in Azospirillum sp. SherDot2

Annotation: 3-dehydroquinate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 381 TIGR01357: 3-dehydroquinate synthase" amino acids 24 to 370 (347 residues), 356.6 bits, see alignment E=7.3e-111 PF01761: DHQ_synthase" amino acids 80 to 191 (112 residues), 155.2 bits, see alignment E=4.9e-50 PF24621: DHQS_C" amino acids 194 to 343 (150 residues), 151.2 bits, see alignment E=2e-48

Best Hits

Swiss-Prot: 61% identical to AROB_RHORT: 3-dehydroquinate synthase (aroB) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K01735, 3-dehydroquinate synthase [EC: 4.2.3.4] (inferred from 95% identity to azl:AZL_000830)

Predicted SEED Role

"3-dehydroquinate synthase (EC 4.2.3.4)" in subsystem Chorismate Synthesis or Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate) or Type IV pilus (EC 4.2.3.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.3.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (381 amino acids)

>MPMX19_02639 3-dehydroquinate synthase (Azospirillum sp. SherDot2)
MTSVNATTPAALDTVRLELGARSYDILVGDGVLGDAGERIAAITRGRAPIVVTDANVAPL
HLDTLNAAMLAAGIAPQPAIVLPAGEKTKDFAHFQQLMDDILGRGIERSTVLLALGGGVI
GDITGFAAASALRGIDFIQVPTTLLSQVDSSVGGKTGINSRHGKNLIGAFHQPRLVIADT
ATLDTLPRREVLAGYAEVVKYGLIRQPDFFAWLERNGRRVVDGDSDARRHAVTVSCRAKA
DIVGVDERESGDRALLNLGHTFGHALEAATGFGQTLLHGEGVAIGMVLAFDLSVRLGLCP
ADDARRARAHLADVGLPVRPADIPGVAWDVDGLVRSMAKDKKVQDGRITFILADRIGNAF
TRRDVDTAAVRAVLAESVQPA