Protein Info for MPMX19_02584 in Azospirillum sp. SherDot2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 460 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 43 to 64 (22 residues), see Phobius details amino acids 127 to 147 (21 residues), see Phobius details amino acids 167 to 187 (21 residues), see Phobius details amino acids 194 to 211 (18 residues), see Phobius details amino acids 230 to 255 (26 residues), see Phobius details amino acids 273 to 295 (23 residues), see Phobius details amino acids 312 to 331 (20 residues), see Phobius details amino acids 360 to 381 (22 residues), see Phobius details amino acids 429 to 451 (23 residues), see Phobius details PF12501: DUF3708" amino acids 8 to 178 (171 residues), 107.3 bits, see alignment E=6.9e-35 TIGR02138: phosphate ABC transporter, permease protein PstC" amino acids 162 to 454 (293 residues), 296.6 bits, see alignment E=8.4e-93 PF00528: BPD_transp_1" amino acids 247 to 450 (204 residues), 58.7 bits, see alignment E=6.5e-20

Best Hits

KEGG orthology group: K02037, phosphate transport system permease protein (inferred from 93% identity to azl:AZL_000250)

Predicted SEED Role

"Phosphate transport system permease protein PstC (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (460 amino acids)

>MPMX19_02584 hypothetical protein (Azospirillum sp. SherDot2)
MQLTLLALILALLTVIGFTIGRSRAAASVGGRVAELHSVPSYHGVYVALWAGLPALLLFV
AWTASEGWFAMQLVLSALPERLTTGDGQSVALLKADILNLARGISTGREADPLVVEAARR
YAALRDLAGWSLLALGASLAVAGLAWGRRRIGPDLRARPAVERVVRVALVVCSLVAILTT
VGIVLSLLFEALRFFSVVSPLDFLFGTHWSPQMAMRADQVGSSGSFGAIPLFAGTLLITV
IAMLVAVPVGLMAAIYMSEYAGRGVRTWLKPALEILAGIPTVVYGFFAALTMAPFVRSVG
EALGLDVSSESALAAGIVMGVMIIPFVSSLSDDVINAVPQSLRDGSYGLGATKSETIRQV
VLPAALPGIVAAVMLAVSRAIGETMIVTMASGLTANMTANPLQAVTTVTTQIATLLVGDQ
EFDSPKTLSAFGLGLVLFLVTLCLNMVALRVVRTYREKYD