Protein Info for MPMX19_02570 in Azospirillum sp. SherDot2

Annotation: Ribosomal RNA small subunit methyltransferase G

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 204 PF02527: GidB" amino acids 22 to 180 (159 residues), 136.7 bits, see alignment E=3e-44 TIGR00138: 16S rRNA (guanine(527)-N(7))-methyltransferase RsmG" amino acids 24 to 176 (153 residues), 123.6 bits, see alignment E=3.7e-40

Best Hits

Swiss-Prot: 67% identical to RSMG_RHOCS: Ribosomal RNA small subunit methyltransferase G (rsmG) from Rhodospirillum centenum (strain ATCC 51521 / SW)

KEGG orthology group: K03501, ribosomal RNA small subunit methyltransferase G [EC: 2.1.1.170] (inferred from 94% identity to azl:AZL_000130)

Predicted SEED Role

"rRNA small subunit 7-methylguanosine (m7G) methyltransferase GidB"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.170

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (204 amino acids)

>MPMX19_02570 Ribosomal RNA small subunit methyltransferase G (Azospirillum sp. SherDot2)
MSGFDAVAFQEATGVSRETLDRLIAYETLLRKWQPKINLVGPSTLPDAWKRHFLDSAQLF
PLLPDGTRVLVDLGSGAGFPGLVLAILGVPQVHLIESDVRKCAFLREVARVCEAPVTVHT
KRIETVTGIEADVVTARALAPLADLFGWAHPFIGSRGKCLFLKGAALDDELTAATQYWTL
APERFDSRTDPSGTILRVSHLERA