Protein Info for MPMX19_02568 in Azospirillum sp. SherDot2

Annotation: tRNA modification GTPase MnmE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 443 PF10396: TrmE_N" amino acids 5 to 121 (117 residues), 129.4 bits, see alignment E=2e-41 TIGR00450: tRNA modification GTPase TrmE" amino acids 10 to 443 (434 residues), 291.1 bits, see alignment E=1.8e-90 PF12631: MnmE_helical" amino acids 124 to 440 (317 residues), 181.5 bits, see alignment E=6.2e-57 PF01926: MMR_HSR1" amino acids 219 to 331 (113 residues), 83.5 bits, see alignment E=2.9e-27 TIGR00231: small GTP-binding protein domain" amino acids 219 to 342 (124 residues), 61.8 bits, see alignment E=6.8e-21 PF02421: FeoB_N" amino acids 219 to 343 (125 residues), 39.6 bits, see alignment E=9.5e-14 PF00350: Dynamin_N" amino acids 220 to 265 (46 residues), 28.1 bits, see alignment 5e-10

Best Hits

Swiss-Prot: 51% identical to MNME_HYPNA: tRNA modification GTPase MnmE (mnmE) from Hyphomonas neptunium (strain ATCC 15444)

KEGG orthology group: K03650, tRNA modification GTPase (inferred from 93% identity to azl:AZL_000110)

Predicted SEED Role

"GTPase and tRNA-U34 5-formylation enzyme TrmE" in subsystem Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (443 amino acids)

>MPMX19_02568 tRNA modification GTPase MnmE (Azospirillum sp. SherDot2)
MSVTTIYALATAPGRSGVAVVRISGPAAGSALVGLTGRPLPAPRRAVLTKLHDPQTGDAL
DDALVLRFTAPASFTGENVVELHLHGGRAVVTGVIEALATLPGLRLAEPGEFTRRAFENG
KLDLTEAEAVADLIDAETTAQRRQALRQMEGALGKLYDGWRERLTRALAHIEADIDFAED
DLPGGVADAVRPVIAGLAGEIASHLDDGGRGERLREGLHIAIVGAPNAGKSSLLNALARR
DAAIVSARAGTTRDIIEVHLDLGGYPVVLADTAGLREAAADEVEEEGIRRARDRAARADV
KVAVFDAATLPDLDPATLDLIDSDTVVVFNKTDLAKAADLRPDLSPILVSAQTGDGLKLL
EDKLTEFSADRLAIGSAPSLTRARHRAALIECRESLLRALEAPLPELAAEDVRLASRALG
RITGRVDVEDLLDVIFRDFCIGK