Protein Info for MPMX19_02546 in Azospirillum sp. SherDot2

Annotation: Histidine biosynthesis bifunctional protein HisB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00475: IGPD
  • amino acids 52 to 195 (144 residues), 225.7 bits, E=1.2e-71

Best Hits

Swiss-Prot: 89% identical to HIS7_AZOBR: Imidazoleglycerol-phosphate dehydratase (hisB) from Azospirillum brasilense

KEGG orthology group: K01693, imidazoleglycerol-phosphate dehydratase [EC: 4.2.1.19] (inferred from 98% identity to azl:AZL_028820)

Predicted SEED Role

"Imidazoleglycerol-phosphate dehydratase (EC 4.2.1.19)" in subsystem Histidine Biosynthesis (EC 4.2.1.19)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (44/46 steps found)
• L-histidine biosynthesis (10/10 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Histidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.19

Protein Sequence (220 amino acids)

>MPMX19_02546 Histidine biosynthesis bifunctional protein HisB (Azospirillum sp. SherDot2)
MLAREDASCYKTAMDQTPINGGRRASIERNTTETRIRVALNLDGTGVYDVKTGVGFLDHM
LEQLSRHSLMDLTVLADGDLHIDYHHTTEDTGIAIGMAVAKALGDRKGIQRYGHSYVPMD
ETLTRVALDFSNRPYLIWKVNFTRDKIGDFDTELFREWFQAFAMAAGVTLHVENLYGENN
HHIVESCYKALARALRAGVEIDPRKRDAVPSTKGTLGGSL