Protein Info for MPMX19_02513 in Azospirillum sp. SherDot2

Annotation: Endoribonuclease YbeY

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 168 PF02130: YbeY" amino acids 24 to 152 (129 residues), 133.1 bits, see alignment E=2.8e-43 TIGR00043: rRNA maturation RNase YbeY" amino acids 44 to 153 (110 residues), 129.3 bits, see alignment E=3.3e-42

Best Hits

Swiss-Prot: 59% identical to YBEY_MAGSA: Endoribonuclease YbeY (ybeY) from Magnetospirillum magneticum (strain AMB-1 / ATCC 700264)

KEGG orthology group: K07042, probable rRNA maturation factor (inferred from 89% identity to azl:AZL_028490)

Predicted SEED Role

"Metal-dependent hydrolase YbeY, involved in rRNA and/or ribosome maturation and assembly"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (168 amino acids)

>MPMX19_02513 Endoribonuclease YbeY (Azospirillum sp. SherDot2)
MTTAVDIAVSREAGDWAEDAEWLAERAALAALGAAYDDEEGPAELSVVLADDELVHRLNR
EYRGKDKPTNVLSFALTEAEEPDAQEGVPVMLGDVILAYETVAREAAEQRKSLQDHLTHL
VMHGVLHLLGYDHETDDEAEEMEALETRLLATLGIADPYAANHQPPDR