Protein Info for MPMX19_02508 in Azospirillum sp. SherDot2

Annotation: GTP cyclohydrolase 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01227: GTP_cyclohydroI
  • amino acids 38 to 215 (178 residues), 247.4 bits, E=3.2e-78
• TIGR00063: GTP cyclohydrolase I
  • amino acids 38 to 215 (178 residues), 220.8 bits, E=4.9e-70

Best Hits

Swiss-Prot: 68% identical to GCH1_XANCP: GTP cyclohydrolase 1 (folE) from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)

KEGG orthology group: K01495, GTP cyclohydrolase I [EC: 3.5.4.16] (inferred from 95% identity to azl:AZL_028440)

MetaCyc: 50% identical to GTP cyclohydrolase I (Bacillus subtilis subtilis 168)
GTP cyclohydrolase I. [EC: 3.5.4.16]

Predicted SEED Role

"GTP cyclohydrolase I (EC 3.5.4.16) type 1" in subsystem Folate Biosynthesis or Molybdenum cofactor biosynthesis or Pterin biosynthesis or Queuosine-Archaeosine Biosynthesis (EC 3.5.4.16)

MetaCyc Pathways

• superpathway of tetrahydrofolate biosynthesis and salvage (10/12 steps found)
• superpathway of tetrahydrofolate biosynthesis (8/10 steps found)
• 6-hydroxymethyl-dihydropterin diphosphate biosynthesis IV (Plasmodium) (2/3 steps found)
• 6-hydroxymethyl-dihydropterin diphosphate biosynthesis I (3/5 steps found)
• tetrahydromonapterin biosynthesis (2/4 steps found)
• drosopterin and aurodrosopterin biosynthesis (4/7 steps found)
• erythro-tetrahydrobiopterin biosynthesis I (1/4 steps found)
• threo-tetrahydrobiopterin biosynthesis (1/4 steps found)
• preQ₀ biosynthesis (1/4 steps found)
• superpathway of chorismate metabolism (38/59 steps found)

KEGG Metabolic Maps

• Folate biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.4.16

Protein Sequence (224 amino acids)

>MPMX19_02508 GTP cyclohydrolase 1 (Azospirillum sp. SherDot2)
MTATKTPHAKPPAADNVLRGPGLSRPDALARPSRADAEEAVRTLIRWAGDDPAREGLVGT
PDRVVRSYEEFFAGYGIDPVEILSRTFEETDGYDEMVVLRDIRVESYCEHHMVPIIGKAH
VAYLPRRRVVGISKLARLVEAYGKRLQIQEKMTAQIANTIDEVLQPEGVAVVVEAQHQCM
TTRGIHKTGVTMVTSRMLGAFRTDPSTRREFLTMIGNPSSRGME