Protein Info for MPMX19_02498 in Azospirillum sp. SherDot2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 231 transmembrane" amino acids 20 to 43 (24 residues), see Phobius details amino acids 63 to 86 (24 residues), see Phobius details amino acids 116 to 137 (22 residues), see Phobius details amino acids 143 to 161 (19 residues), see Phobius details amino acids 183 to 213 (31 residues), see Phobius details PF07264: EI24" amino acids 5 to 203 (199 residues), 116.4 bits, see alignment E=9.2e-38

Best Hits

KEGG orthology group: None (inferred from 93% identity to azl:AZL_028350)

Predicted SEED Role

"Arginine/ornithine antiporter ArcD" in subsystem Arginine Deiminase Pathway or Arginine and Ornithine Degradation or Polyamine Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (231 amino acids)

>MPMX19_02498 hypothetical protein (Azospirillum sp. SherDot2)
MIRALVLAFAQLSDPRVRRVVWTGVFVSLLAYALLALGASWALSATPLTGYGWIDATIDV
MGGLGVLVLAWLLFPATVGTVSSFFLDEVVERVEARHYPGLPAPRQAGWLEELATALRFL
LLVLAVNLAALPIYIFAPGLNLIVFYTINGYLLGREYFEMVAHRRMDRAAARAMRRARPL
KPFLAGVVIAFLSTIPFANLLVPVVASAFMVHVLQSMSAPLAAGRTTVIRR