Protein Info for MPMX19_02446 in Azospirillum sp. SherDot2

Annotation: Release factor glutamine methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF17827: PrmC_N
  • amino acids 6 to 75 (70 residues), 73.7 bits, E=5.8e-24
• TIGR00536: methyltransferase, HemK family
  • amino acids 7 to 277 (271 residues), 194 bits, E=3e-61
• TIGR03534: protein-(glutamine-N5) methyltransferase, release factor-specific
  • amino acids 25 to 276 (252 residues), 267 bits, E=1.6e-83
• PF05175: MTS
  • amino acids 113 to 191 (79 residues), 46.7 bits, E=1.1e-15
• PF06325: PrmA
  • amino acids 114 to 187 (74 residues), 36.9 bits, E=1.2e-12
• PF13847: Methyltransf_31
  • amino acids 115 to 241 (127 residues), 47.1 bits, E=8.1e-16
• PF08242: Methyltransf_12
  • amino acids 118 to 187 (70 residues), 31.8 bits, E=7.7e-11
• PF13649: Methyltransf_25
  • amino acids 118 to 198 (81 residues), 36.5 bits, E=2.6e-12
• PF08241: Methyltransf_11
  • amino acids 119 to 187 (69 residues), 22.3 bits, E=6.8e-08
• PF01170: UPF0020
  • amino acids 138 to 191 (54 residues), 22.7 bits, E=2.8e-08

Best Hits

Swiss-Prot: 48% identical to PRMC_AGRFC: Release factor glutamine methyltransferase (prmC) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K02493, methyltransferase [EC: 2.1.1.-] (inferred from 89% identity to azl:AZL_001420)

Predicted SEED Role

"Protein-N(5)-glutamine methyltransferase PrmC, methylates polypeptide chain release factors RF1 and RF2"

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Protein Sequence (282 amino acids)

>MPMX19_02446 Release factor glutamine methyltransferase (Azospirillum sp. SherDot2)
MNLRALRAQAEARLRKAGVDTPELDARYLLEHALTLTRTDFVTKAEQHIPDADAAHALAL
VERRAAREPVGRILGHREFWTIDLALNPDTLEPRPDTETVVEAVLAAISDRKAPLHLIDF
GTGTGCILLALLSELPNATGVGVDLSPLAVEAAAGNADRNGLAERARFQTGDWAKGIAER
FDIVVSNPPYIPSADIATLEPEVREHDPLRALDGGPDGLEPYRILAAELPRLLVPGGLVA
FEVGQGQAEDVAALVGAQGLGDIAILCDLGGVKRCVRARKSL