Protein Info for MPMX19_02410 in Azospirillum sp. SherDot2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 131 transmembrane" amino acids 32 to 51 (20 residues), see Phobius details amino acids 62 to 84 (23 residues), see Phobius details amino acids 104 to 129 (26 residues), see Phobius details PF01127: Sdh_cyt" amino acids 7 to 116 (110 residues), 80.1 bits, see alignment E=1.5e-26 TIGR02968: succinate dehydrogenase, hydrophobic membrane anchor protein" amino acids 21 to 124 (104 residues), 84.8 bits, see alignment E=2.2e-28

Best Hits

Swiss-Prot: 34% identical to DHSD_RICBR: Succinate dehydrogenase hydrophobic membrane anchor subunit (sdhD) from Rickettsia bellii (strain RML369-C)

KEGG orthology group: K00242, succinate dehydrogenase hydrophobic membrane anchor protein (inferred from 96% identity to azl:AZL_001740)

Predicted SEED Role

"Succinate dehydrogenase hydrophobic membrane anchor protein" in subsystem Succinate dehydrogenase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (131 amino acids)

>MPMX19_02410 hypothetical protein (Azospirillum sp. SherDot2)
MASNSKTLRSPLQVARGLGSAKHGTEHWWSQRLTAIALVPLTVWFVFGVIRHLGADHAAF
IAWMKSPFSAVMMILTAVVTFHHAQSGLQVVIEDYVHAEWQKMALIIGVKFLSFALAAAC
VLAVVKIFIGA