Protein Info for MPMX19_02313 in Azospirillum sp. SherDot2

Annotation: Oxygen-independent coproporphyrinogen III oxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 475 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details TIGR00538: oxygen-independent coproporphyrinogen III oxidase" amino acids 26 to 473 (448 residues), 447.4 bits, see alignment E=2.9e-138 PF04055: Radical_SAM" amino acids 77 to 247 (171 residues), 84 bits, see alignment E=1.5e-27 PF06969: HemN_C" amino acids 384 to 452 (69 residues), 26.2 bits, see alignment E=6.6e-10

Best Hits

Swiss-Prot: 54% identical to HEMN_BRADU: Oxygen-independent coproporphyrinogen III oxidase (hemN) from Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)

KEGG orthology group: K02495, oxygen-independent coproporphyrinogen III oxidase [EC: 1.3.99.22] (inferred from 90% identity to azl:AZL_002490)

Predicted SEED Role

"Coproporphyrinogen III oxidase, oxygen-independent (EC 1.3.99.22)" in subsystem Experimental tye or Heme and Siroheme Biosynthesis (EC 1.3.99.22)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.3.99.22

Use Curated BLAST to search for 1.3.99.22

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (475 amino acids)

>MPMX19_02313 Oxygen-independent coproporphyrinogen III oxidase (Azospirillum sp. SherDot2)
MNAITALAVSPAPANPSHSHGVAHGVDAALLAKYDGLRVPRYTSYPTAPHFTPEVNGDVY
GGWLEAIEPSRSGSLYLHVPFCQKMCWYCGCHTKIVARYEPIAEYLDHMRREIAMVADRI
PGRLAVRHIHFGGGTPTMMAPDDFEAMIALLLKRFDVADDAELAVEIDPRTLTAEMASAM
GRAGVNRASLGVQDFDETVQQAINRVQPRAVTEQALAWLKDSGIASVNLDLMYGLPHQSV
ESVARSAEIALEMAPDRLSVFGYAHVPWMKTHQKKIDESVLAGSLGRWEQFAAIADTLSA
AGYSAIGLDHFARPGDELAVQQEEGRLGRNFQGYTTDDAETLLGFGSSSIGALPQGYVQN
AVPFDHYATAIEEGRLPTGKGIALTQDDKVRRDLIMRLMCDLSVDTAAIARAHGLPESAF
DAELEGMADLVADGVAVVDGRRIHVPESARPLMRIVAARFDTHLSKGAGRHSRAV