Protein Info for MPMX19_02217 in Azospirillum sp. SherDot2

Annotation: Pseudouridine-5'-phosphate glycosidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04227: Indigoidine_A
  • amino acids 10 to 299 (290 residues), 431.2 bits, E=9.7e-134

Best Hits

Swiss-Prot: 66% identical to PSUG_RHOCS: Pseudouridine-5'-phosphate glycosidase (psuG) from Rhodospirillum centenum (strain ATCC 51521 / SW)

KEGG orthology group: None (inferred from 88% identity to azl:AZL_003100)

MetaCyc: 54% identical to pseudouridine-5'-phosphate glycosidase (Escherichia coli K-12 substr. MG1655)
Pseudouridylate synthase. [EC: 4.2.1.70]

Predicted SEED Role

"Indigoidine synthase A-like protein, uncharacterized enzyme involved in pigment biosynthesis"

MetaCyc Pathways

• pseudouridine degradation (1/2 steps found)

KEGG Metabolic Maps

• Pyrimidine metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.70

Use Curated BLAST to search for 4.2.1.70

Protein Sequence (304 amino acids)

>MPMX19_02217 Pseudouridine-5'-phosphate glycosidase (Azospirillum sp. SherDot2)
MHPILLPTPEIADALAMGHPVVALESTVISHGMPYPRNLETARALEAEVRAAGALPATIA
VMDGRIRIGLDDEALERLATAGHAARKLSRRDLPVALATKALGATTVAATMIGARLAGIS
VFATGGIGGVHRGAETSFDISADLDELARTSVCVVCAGAKSILDLPKTLELLETRGVPVL
GFGTEEFPAFYSRRSGLSVDHRCDTVQEIAEILRTKWQLGLEGGVLLATPIPAADELDAD
AMEAAVAQALVDADAKRIKGKDITPHLLAALEAITGGRSLTANIALIRNNARVAAGVAAA
FANT