Protein Info for MPMX19_02210 in Azospirillum sp. SherDot2

Annotation: ATM1-type heavy metal exporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 631 transmembrane" amino acids 44 to 65 (22 residues), see Phobius details amino acids 81 to 101 (21 residues), see Phobius details amino acids 164 to 187 (24 residues), see Phobius details amino acids 193 to 213 (21 residues), see Phobius details amino acids 276 to 298 (23 residues), see Phobius details amino acids 317 to 332 (16 residues), see Phobius details PF00664: ABC_membrane" amino acids 45 to 325 (281 residues), 153.3 bits, see alignment E=1.2e-48 PF00005: ABC_tran" amino acids 387 to 536 (150 residues), 112.1 bits, see alignment E=3.3e-36

Best Hits

Swiss-Prot: 52% identical to ATM1_GIBZE: Iron-sulfur clusters transporter ATM1, mitochondrial (ATM1) from Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084)

KEGG orthology group: K06147, ATP-binding cassette, subfamily B, bacterial (inferred from 89% identity to azl:AZL_003280)

Predicted SEED Role

"Lipid A export ATP-binding/permease protein MsbA" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (631 amino acids)

>MPMX19_02210 ATM1-type heavy metal exporter (Azospirillum sp. SherDot2)
MRRSLPPTSDTSAFTRPSGDLRAAIRSLGPYIWPRDSVETRVRVVLAMLLLIGAKVANVY
VPIFYKHAVDALTPASAGGSVGPGAAVTIPLGLIVAYGLARVTSLVFAELRDAVFATVAQ
RTIRRVALSVFRHLHALSLRFHLERQTGGLTRSLERGTRAIESLLRYTLFSIVPTLVEIA
LVCAILWKLFSVWFALATFVTVMGYILYTFFVSEWRIKFRRLMNDTDSKANTKAIDSLLN
YETVKYFGNEEHEARRYDGALQSYEKAAVRSQQSLSLLNVGQSAIISLGLAAVMGMAAKG
IVDGSMSLGDFVLVNTYLLQLYQPLNFFGVVYREIKQSLIDIESMVTLLAVDREVADGPD
AKPLAVDGAELRFEGVEFGYDPRRPILKDVSFTVPAGRTVAIVGPSGAGKSTISRLLFRF
YDVNGGRVLIDGQDIRGVTQASLRGSIGIVPQDTVLFNDTVFYNIAYGRPGAGPAEVERA
ARLAHIHDFIMALPDGYQTTVGERGLKLSGGEKQRVAIARTILKDPAILLFDEATSALDT
HTEREIQANLREVSRGRTTLVIAHRLSTVIDADEILVLEAGRVIERGHHTDLLAARGAYA
ALWARQQEASQAAVGASTGGPAPLPGVLAPT