Protein Info for MPMX19_02200 in Azospirillum sp. SherDot2

Annotation: Spermidine/putrescine transport system permease protein PotB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 294 transmembrane" amino acids 12 to 38 (27 residues), see Phobius details amino acids 77 to 100 (24 residues), see Phobius details amino acids 106 to 124 (19 residues), see Phobius details amino acids 130 to 150 (21 residues), see Phobius details amino acids 161 to 180 (20 residues), see Phobius details amino acids 216 to 237 (22 residues), see Phobius details amino acids 264 to 285 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 121 to 281 (161 residues), 56.1 bits, see alignment E=2.1e-19

Best Hits

KEGG orthology group: K11071, spermidine/putrescine transport system permease protein (inferred from 97% identity to azl:AZL_003300)

Predicted SEED Role

"Spermidine Putrescine ABC transporter permease component PotB (TC 3.A.1.11.1)" in subsystem Polyamine Metabolism (TC 3.A.1.11.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (294 amino acids)

>MPMX19_02200 Spermidine/putrescine transport system permease protein PotB (Azospirillum sp. SherDot2)
MTEVLRRYGPVLTGVILLAVAVWLALLVLLPQLMMIGFSFRPSLPPSKIGGPEDVFTVRN
YLTLWTNQIHLSIFLKTIWASALVTATTLAVCYPVAYYLAQVAPKRRLPLLILMLVVPFW
INELLRTFSWYIILAFNGPLNAILLGLGIIDEPQRFLGGDAGVIVGMVYVYILFMVFPLY
NAIESLDRNQIEAARDLGAGWLRIHRRIVLPHAKPGVAVGCIMTFMLAAGSYAVPALLGG
PNSRWFTEIIYNWFFEGGNWNQGAAYAFILLVLCIGFILGAMRLFRVGLADIAK