Protein Info for MPMX19_02178 in Azospirillum sp. SherDot2

Annotation: Ornithine carbamoyltransferase, anabolic

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02729: OTCace_N
  • amino acids 13 to 155 (143 residues), 165.5 bits, E=8.9e-53
• TIGR00658: ornithine carbamoyltransferase
  • amino acids 13 to 313 (301 residues), 366.2 bits, E=6.3e-114
• PF00185: OTCace
  • amino acids 162 to 311 (150 residues), 172 bits, E=1e-54

Best Hits

Swiss-Prot: 60% identical to OTC_RHOP5: Ornithine carbamoyltransferase (argF) from Rhodopseudomonas palustris (strain BisA53)

KEGG orthology group: None (inferred from 95% identity to azl:AZL_004170)

MetaCyc: 44% identical to L-ornithine carbamoyltransferase (Sulfolobus acidocaldarius)
Ornithine carbamoyltransferase. [EC: 2.1.3.3]

Predicted SEED Role

"Ornithine carbamoyltransferase (EC 2.1.3.3)" in subsystem Arginine Biosynthesis extended or Arginine Deiminase Pathway or Arginine and Ornithine Degradation (EC 2.1.3.3)

MetaCyc Pathways

• L-arginine biosynthesis II (acetyl cycle) (10/10 steps found)
• L-arginine biosynthesis I (via L-ornithine) (9/9 steps found)
• superpathway of arginine and polyamine biosynthesis (14/17 steps found)
• L-citrulline biosynthesis (7/8 steps found)
• L-citrulline degradation (3/3 steps found)
• L-arginine degradation XIII (reductive Stickland reaction) (4/5 steps found)
• urea cycle (4/5 steps found)
• superpathway of L-citrulline metabolism (9/12 steps found)
• L-arginine degradation V (arginine deiminase pathway) (3/4 steps found)
• L-arginine biosynthesis IV (archaea) (4/9 steps found)
• L-arginine degradation XIV (oxidative Stickland reaction) (1/6 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.3.3

Protein Sequence (317 amino acids)

>MPMX19_02178 Ornithine carbamoyltransferase, anabolic (Azospirillum sp. SherDot2)
MNGDNNTANGTVRHFLDIDRMDGATLRRLLDHAVRIKADLKKDRLAHSTLLAGRSLALIF
EKPSTRTRVSFEVGMQQFGGNVVVLKPDDMQLGRGETIGDTARVLSRFVDAVMVRTTGEE
RVHELAAHASIPIINGLTDQTHPCQIMADLMTFEEHRGPINGRTVAWIGDCNNVAVSWAH
AAVRFGFELRLACPTVYGPSPELLAWAEREGSGRLVVTDSPEEAVRGAECVITDAWASMH
NTDVDERAAILAPYQVNEALMAHAHPEALFMHCLPAHRNEEVTDGVIDGRHSVVWDEAEN
RLHAQKAILGWCMGVLD