Protein Info for MPMX19_02176 in Azospirillum sp. SherDot2

Annotation: Inner membrane transport permease YadH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 260 transmembrane" amino acids 32 to 54 (23 residues), see Phobius details amino acids 65 to 89 (25 residues), see Phobius details amino acids 110 to 136 (27 residues), see Phobius details amino acids 145 to 167 (23 residues), see Phobius details amino acids 174 to 195 (22 residues), see Phobius details amino acids 201 to 221 (21 residues), see Phobius details amino acids 229 to 249 (21 residues), see Phobius details PF01061: ABC2_membrane" amino acids 13 to 222 (210 residues), 108.3 bits, see alignment E=4.2e-35 PF12698: ABC2_membrane_3" amino acids 62 to 249 (188 residues), 38.6 bits, see alignment E=7.3e-14

Best Hits

Swiss-Prot: 41% identical to YADH_SHIFL: Inner membrane transport permease YadH (yadH) from Shigella flexneri

KEGG orthology group: K09686, antibiotic transport system permease protein (inferred from 95% identity to azl:AZL_004190)

Predicted SEED Role

"ABC-type multidrug transport system, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (260 amino acids)

>MPMX19_02176 Inner membrane transport permease YadH (Azospirillum sp. SherDot2)
MPRNVGSVNWIGLWTLYAREVRRFIKVHQQTVWAPVVTTLLYYAVFALSLGSAVRMVGPT
PYLEFLAPGLIMMAMVQNAFANTSSSVVIAKVQGNIVDILMPPLSPMELVSGFVLGGVTR
GVVVGLVTGLAIWAVIPMHMPHPGFVVFHAVMASMLLALLGLVGGVWSEKFDNIAAVTNF
VVTPLSFLSGTFYSVDTLPPVFWWVAHFDPFFYMIDGFRYGFIGVSDGARWLGVAVMLGV
NIGLWWLAWRMFKTGYKLKA