Protein Info for MPMX19_02134 in Azospirillum sp. SherDot2

Annotation: Phage shock protein C

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 133 transmembrane" amino acids 44 to 68 (25 residues), see Phobius details TIGR02978: phage shock protein C" amino acids 13 to 131 (119 residues), 120 bits, see alignment E=2.6e-39 PF04024: PspC" amino acids 14 to 70 (57 residues), 66.4 bits, see alignment E=7.8e-23

Best Hits

KEGG orthology group: K03973, phage shock protein C (inferred from 96% identity to azl:AZL_003950)

Predicted SEED Role

"Phage shock protein C"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (133 amino acids)

>MPMX19_02134 Phage shock protein C (Azospirillum sp. SherDot2)
MDRASPYDSPNPHRLYRDPQRGVLGGVCTGIADYFGMQPGVVRLAMLVALFFFSVPLVIA
YVIALIVLPVRPPQLYRDAEEEAFWRTVSTKPDRTLAGLTQRFRDMEKRIVGMEAYVASK
EFELNRAIRDLDR