Protein Info for MPMX19_02101 in Azospirillum sp. SherDot2

Annotation: ATP synthase subunit beta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 473 TIGR01039: ATP synthase F1, beta subunit" amino acids 7 to 470 (464 residues), 842.4 bits, see alignment E=4.6e-258 PF02874: ATP-synt_ab_N" amino acids 10 to 76 (67 residues), 76.3 bits, see alignment E=3.3e-25 PF00006: ATP-synt_ab" amino acids 133 to 352 (220 residues), 229.9 bits, see alignment E=4.1e-72 PF22919: ATP-synt_VA_C" amino acids 358 to 446 (89 residues), 61.3 bits, see alignment E=1.2e-20

Best Hits

Swiss-Prot: 85% identical to ATPB_MAGSA: ATP synthase subunit beta (atpD) from Magnetospirillum magneticum (strain AMB-1 / ATCC 700264)

KEGG orthology group: K02112, F-type H+-transporting ATPase subunit beta [EC: 3.6.3.14] (inferred from 98% identity to azl:AZL_024920)

MetaCyc: 80% identical to ATP synthase subunit beta, mitochondrial (Homo sapiens)

Predicted SEED Role

"ATP synthase beta chain (EC 3.6.3.14)" in subsystem F0F1-type ATP synthase (EC 3.6.3.14)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (473 amino acids)

>MPMX19_02101 ATP synthase subunit beta (Azospirillum sp. SherDot2)
MATTNSVGKITQVTGAVVDVQFSGDLPAILNALHTQNDGKTLVLEVAQHLGESTVRTIAM
DSTDGLVRGSEVTDTGNPIAVPVGPETLGRIINVIGEPIDERGAVNAARTLPIHRQAPDF
VDQSTDAEVLITGIKVIDLLAPYAKGGKIGLFGGAGVGKTVTIMELINNVAKAHGGVSVF
AGVGERTREGNDLYHEMIESGVIKLDGPGSKVALVYGQMNEPPGARARVALSGLTLAEYF
RDEEGQDVLFFVDNIFRFTQAGSEVSALLGRIPSAVGYQPTLGTDMGALQERITSTKKGS
ITSVQAIYVPADDLTDPAPAASFAHLDATTVLSRSIAEMAIFPAVDPLDSTSRILDPRVV
GEEHYGVARSVQKVLQTYKSLQDIIAILGMDELSEEDKLVVARARKIQRFLSQPFHVAEV
FTGTPGVLVPLEETIKGFKGIVNGDYDHLPEAAFYMVGTIDEAIAKAKKLAAA