Protein Info for MPMX19_02083 in Azospirillum sp. SherDot2

Annotation: Dihydroorotate dehydrogenase (quinone)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 357 TIGR01036: dihydroorotate dehydrogenase (fumarate)" amino acids 5 to 357 (353 residues), 422.9 bits, see alignment E=4.2e-131 PF01180: DHO_dh" amino acids 44 to 339 (296 residues), 302.8 bits, see alignment E=1.2e-94

Best Hits

Swiss-Prot: 61% identical to PYRD_RHORT: Dihydroorotate dehydrogenase (quinone) (pyrD) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K00254, dihydroorotate dehydrogenase [EC: 1.3.5.2] (inferred from 94% identity to azl:AZL_024760)

Predicted SEED Role

"Dihydroorotate dehydrogenase (EC 1.3.3.1)" in subsystem De Novo Pyrimidine Synthesis (EC 1.3.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.3.1 or 1.3.5.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (357 amino acids)

>MPMX19_02083 Dihydroorotate dehydrogenase (quinone) (Azospirillum sp. SherDot2)
MIDLYPLAGPLLFRFDPETAHGLTIKALKSGLVPPARGRDEPALHTRVWGLDLANPVGLA
AGFDKNAEVVDAMLNLGFGFVEPGSVTPRPQPGNPRPRLFRLVEQRAVINRMGFNNEGLE
AFAQRLERRRDSAKRAPGIVGANLGKNKDTVDAADDYVIGVRRLAPLADYLVVNVSSPNT
PGLRALQGRDPLRALLERVLEARASCGLTRNPPLLLKIAPDLTVEDKSDIAAVALESGID
GLIVSNTTIARPDSIPAAMRSEAGGLSGRPLFEASTSVLREIYALTGGKLPIVGVGGVAT
GEDAYAKIRAGASLVQLYSAMVYAGPAVVHRIRRELAGLLRRDGFRSVAEAVGADHR