Protein Info for MPMX19_02080 in Azospirillum sp. SherDot2

Annotation: Translation initiation factor IF-3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 144 TIGR00168: translation initiation factor IF-3" amino acids 2 to 144 (143 residues), 207.4 bits, see alignment E=5.5e-66 PF05198: IF3_N" amino acids 2 to 52 (51 residues), 78.4 bits, see alignment E=3.6e-26 PF00707: IF3_C" amino acids 59 to 143 (85 residues), 135.8 bits, see alignment E=4.1e-44

Best Hits

Swiss-Prot: 70% identical to IF3_XANP2: Translation initiation factor IF-3 (infC) from Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)

KEGG orthology group: K02520, translation initiation factor IF-3 (inferred from 85% identity to rce:RC1_2820)

Predicted SEED Role

"Translation initiation factor 3"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (144 amino acids)

>MPMX19_02080 Translation initiation factor IF-3 (Azospirillum sp. SherDot2)
MIGVVSLRDALLAAEDAGLDLVEIAPQAEPPVCKILDYGRFRYEAQKKANEARKKQKIIE
VKEIKLRPNIDDNDYDVKMRSARRFLEEGDKVKVTLRFRGREMAHQDLGMNVLVRVRDEL
EALAKVEQMPKLEGRQMVMVLAPR