Protein Info for MPMX19_02061 in Azospirillum sp. SherDot2

Annotation: Sensor histidine kinase RcsC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 861 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 42 to 63 (22 residues), see Phobius details amino acids 75 to 98 (24 residues), see Phobius details amino acids 107 to 127 (21 residues), see Phobius details amino acids 139 to 160 (22 residues), see Phobius details amino acids 172 to 191 (20 residues), see Phobius details PF07694: 5TM-5TMR_LYT" amino acids 40 to 191 (152 residues), 49.3 bits, see alignment E=1.7e-16 TIGR00229: PAS domain S-box protein" amino acids 205 to 328 (124 residues), 83.8 bits, see alignment E=5.5e-28 PF00989: PAS" amino acids 209 to 318 (110 residues), 45.1 bits, see alignment E=3.7e-15 PF08448: PAS_4" amino acids 215 to 323 (109 residues), 33.5 bits, see alignment E=1.7e-11 PF13426: PAS_9" amino acids 219 to 320 (102 residues), 39.8 bits, see alignment E=1.9e-13 PF08447: PAS_3" amino acids 232 to 314 (83 residues), 54.4 bits, see alignment E=5.2e-18 PF00512: HisKA" amino acids 342 to 406 (65 residues), 69.1 bits, see alignment 1.1e-22 PF02518: HATPase_c" amino acids 453 to 575 (123 residues), 103.4 bits, see alignment E=3.8e-33 PF00072: Response_reg" amino acids 598 to 710 (113 residues), 85.8 bits, see alignment E=9.6e-28

Best Hits

Predicted SEED Role

"Circadian input kinase A" in subsystem Cyanobacterial Circadian Clock

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (861 amino acids)

>MPMX19_02061 Sensor histidine kinase RcsC (Azospirillum sp. SherDot2)
MLGNFSSMAYDLAENIAASAFVVLAYTFLIRRSGGWSLYTRQIVFGAVMALTAIFSMVHP
IHIGPGIFIDARAPLIGLSALFGGPLSSAITAVTVAGYRIFLGGVGMEAGVANALLSFLT
GVGFAMWSKRRGMAMGVGPLLGFGLLLTLVSTSTLLLLPTWDLALQVGQRTAPALLAIIP
LGTLFLGGLLLREQRHHDAERRLGESEARYRLLADNATDMILEMKADGAVHYLSPSVRDI
LGHNPAEIVGSAPANLLHPDDLESAAMAFAGLQPGSPPVTFTHRLRHRDGHYLWVESSMR
PTVGSDGGFVVVGVVRDVTERKRYEEELSAARAEAEAANRVKSEFLASMSHEIRTPLNGV
IGFADLLLGTELTAEQRQYVSLQREAGRGLLAIIGDILDYSKIEAGKLELEERAFDLHRL
LRDCRDLMSNAASQKGLLLQLSLGGTVPRYVRGDEARIRQILLNLVGNAVKFTERGSVLV
SAGLLSGQGGGEGEAVPAAHVRLSVSDTGPGIPATDQANLFQRFSQGDRSTTRRYGGTGL
GLIISKQLSELMGGHIGVQSSPGVGSTFWFELPLPVATAPGLSTVERRDAAPTRSARILL
AEDVPMNQIVTSSILCKAGHTVEVAEDGILAVEAMRRGEFDLVLMDMQMPRMDGLQATAA
IRQLGGRRGAVPIIALTANALTDQLQLCLDVGMNDHVTKPIERETLLSAVGRWLEAGTDG
MLPEGDAVEEATVLAGVATVSDSAPVLNRATLDTLAETLGADVLPRFIAGTLAELALRTD
RISEADSSKAAAADAHAMVSLAGNVGLLELSRTARKLQHACEQQWPDEPVLKADLRDAVN
RASSALQAALPTLGVAVETAR