Protein Info for MPMX19_02048 in Azospirillum sp. SherDot2

Annotation: Putative glutamine amidotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF07722: Peptidase_C26
  • amino acids 50 to 206 (157 residues), 152.2 bits, E=1.9e-48
• PF00117: GATase
  • amino acids 90 to 222 (133 residues), 48.9 bits, E=6.5e-17

Best Hits

KEGG orthology group: K07010, putative glutamine amidotransferase (inferred from 89% identity to azl:AZL_024470)

Predicted SEED Role

"Para-aminobenzoate synthase, amidotransferase component (EC 2.6.1.85)" in subsystem Chorismate: Intermediate for synthesis of PAPA antibiotics, PABA, anthranilate, 3-hydroxyanthranilate and more. or Folate Biosynthesis or Tryptophan synthesis (EC 2.6.1.85)

MetaCyc Pathways

• superpathway of tetrahydrofolate biosynthesis and salvage (10/12 steps found)
• L-citrulline biosynthesis (7/8 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (4/4 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (4/4 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• superpathway of tetrahydrofolate biosynthesis (8/10 steps found)
• 4-aminobenzoate biosynthesis I (2/2 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• superpathway of L-citrulline metabolism (9/12 steps found)
• L-glutamine degradation I (1/1 steps found)
• L-glutamate and L-glutamine biosynthesis (4/7 steps found)
• superpathway of candicidin biosynthesis (4/11 steps found)
• superpathway of chorismate metabolism (38/59 steps found)
• chloramphenicol biosynthesis (2/9 steps found)

KEGG Metabolic Maps

• Biosynthesis of phenylpropanoids
• Folate biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.85

Use Curated BLAST to search for 2.6.1.85

Protein Sequence (247 amino acids)

>MPMX19_02048 Putative glutamine amidotransferase (Azospirillum sp. SherDot2)
MAAIVGRSRPLVGITASIHGSRIAAMANRLALWRAGASSVRITAESPFPIDRLDALVVGG
GDDIDASLYGESARPHIRIDPERDRLEMLALDCAAKIGLPVLGICRGSQMINVHRGGSLH
VDIHEVYDEAPHMRTVLPRKRIRIAPDSRLYRILGIAECRVNALHHQSVDRVGDGLRVVA
RERAGVVQGIEAPNEPFMIGVQWHPEYLVADSRQQALFRRLVDTAAGTAPLDELVEVPSH
RSVRASG