Protein Info for MPMX19_02021 in Azospirillum sp. SherDot2

Annotation: Anti-sigma-E factor ChrR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 224 TIGR02451: anti-sigma factor, putative, ChrR family" amino acids 6 to 222 (217 residues), 170.1 bits, see alignment E=2.9e-54 PF12973: Cupin_7" amino acids 118 to 201 (84 residues), 36.1 bits, see alignment E=2.4e-13

Best Hits

Swiss-Prot: 41% identical to CHRR_RHOS4: Anti-sigma-E factor ChrR (chrR) from Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158)

KEGG orthology group: K07167, putative transcriptional regulator (inferred from 80% identity to azl:AZL_024230)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (224 amino acids)

>MPMX19_02021 Anti-sigma-E factor ChrR (Azospirillum sp. SherDot2)
MNRPSHHPGDTLLIDYAGGALCEGASLAVATHMAFCPACRHAVAEMEAVGGALLDDLEPE
PLSDGCLEALMARLDHERPAPCRPAVKPSAQQSRYPEPLRSYLRGRLDREGRLGEGGWRF
LQPGMRSMDLLSGPDGTTKLIRMKGGVGVPVHTHGGIELTVVLEGGFSDEFGAFLPGDIA
VGDPSLIHRPVSDPEGCLCLATTIGGLRMTGPLGRLFNRFVKRF