Protein Info for MPMX19_02008 in Azospirillum sp. SherDot2

Annotation: Adenosylcobinamide-GDP ribazoletransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 278 transmembrane" amino acids 22 to 37 (16 residues), see Phobius details amino acids 58 to 83 (26 residues), see Phobius details amino acids 132 to 152 (21 residues), see Phobius details amino acids 158 to 177 (20 residues), see Phobius details amino acids 197 to 215 (19 residues), see Phobius details amino acids 221 to 238 (18 residues), see Phobius details amino acids 259 to 277 (19 residues), see Phobius details TIGR00317: cobalamin 5'-phosphate synthase" amino acids 24 to 265 (242 residues), 112.7 bits, see alignment E=1.2e-36 PF02654: CobS" amino acids 24 to 263 (240 residues), 167.7 bits, see alignment E=2.1e-53

Best Hits

Swiss-Prot: 50% identical to COBS_BRADU: Adenosylcobinamide-GDP ribazoletransferase (cobS) from Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)

KEGG orthology group: K02233, adenosylcobinamide-GDP ribazoletransferase [EC: 2.7.8.26] (inferred from 82% identity to azl:AZL_024060)

Predicted SEED Role

"Cobalamin synthase" in subsystem Cobalamin synthesis or Coenzyme B12 biosynthesis

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.8.26

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (278 amino acids)

>MPMX19_02008 Adenosylcobinamide-GDP ribazoletransferase (Azospirillum sp. SherDot2)
MPIMPDATTAPSPPPRWTQDAALALVFLTRLPLPPIGPLNGLLSGPLAEGSSARAMGWFP
PVGALIGLAGGGVYAATAALHLPPLAGALLALAATVRLTGGLHEDGAADVADGFGGGRDL
ARKLEIMRDSRVGSYGVLALVFSVGIRAAALAALPVPAAVAALVAAGALSRCGLAAMART
LPAARRDGLAAAQGRPAMATVLLALLFGIAIAAVALGGLALPALAASLLAVAAVAALARR
QIGGHTGDVFGAAQQAAEAAVLLTLSALVGAAAIGAAA