Protein Info for MPMX19_01960 in Azospirillum sp. SherDot2

Annotation: L-2-hydroxyglutarate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01266: DAO
  • amino acids 6 to 370 (365 residues), 182.8 bits, E=2.1e-57
• PF13450: NAD_binding_8
  • amino acids 8 to 46 (39 residues), 30 bits, 7.6e-11
• PF01593: Amino_oxidase
  • amino acids 15 to 90 (76 residues), 23 bits, E=6.8e-09

Best Hits

KEGG orthology group: None (inferred from 91% identity to azl:AZL_023560)

Predicted SEED Role

"Aminobutyraldehyde dehydrogenase (EC 1.2.1.19)" (EC 1.2.1.19)

MetaCyc Pathways

• putrescine degradation IV (2/3 steps found)
• L-lysine degradation X (4/6 steps found)
• putrescine degradation I (1/2 steps found)
• putrescine degradation V (1/2 steps found)
• L-lysine degradation I (3/7 steps found)
• superpathway of L-arginine and L-ornithine degradation (7/13 steps found)
• superpathway of ornithine degradation (3/8 steps found)
• superpathway of L-arginine, putrescine, and 4-aminobutanoate degradation (5/11 steps found)
• superpathway of L-lysine degradation (13/43 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Urea cycle and metabolism of amino groups
• beta-Alanine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.2.1.19

Protein Sequence (389 amino acids)

>MPMX19_01960 L-2-hydroxyglutarate dehydrogenase (Azospirillum sp. SherDot2)
MERVECVVVGAGVVGLAVARRLARAGREVIVLEEADAIGTGTSSRNSEVIHAGIYYPTGS
LRARLCVPGRDALYDYCAAHGVEHRRIGKLIVATEEAQLPKLAAIRAQATANGVTDLTEI
DAATAMRWEPNLRTVGALLSPSTGIIDSHGLMLALLGDAEDSGAMLALLSPLERSHRTAA
GFELEVGGAEPMRIACSTLVNAAGLGAWAVARGLEGLEGLEAAHVPPRVLAKGNYYALAA
GRSPFSRLVYPVPVEGGLGVHLTLDLAGQARFGPDVEWLGDVNGGIDYTVDPARADSFYG
AVRTYWPGLPDKALVPAYSGVRPKLSGPGQPQADFLIQGPGIHGVAGLVNLFGIESPGLT
SCLAIADAVAVELGEAPEILNHSRGAQGS