Protein Info for MPMX19_01945 in Azospirillum sp. SherDot2

Annotation: RNA pyrophosphohydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00293: NUDIX
  • amino acids 17 to 153 (137 residues), 76.8 bits, E=8.5e-26

Best Hits

Swiss-Prot: 60% identical to RPPH_RHORT: RNA pyrophosphohydrolase (rppH) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K08311, putative (di)nucleoside polyphosphate hydrolase [EC: 3.6.1.-] (inferred from 92% identity to azl:AZL_023400)

Predicted SEED Role

"FIG000735: Adenosine (5')-pentaphospho-(5'')-adenosine pyrophosphohydrolase (EC 3.6.1.-)" (EC 3.6.1.-)

KEGG Metabolic Maps

• Folate biosynthesis
• Lipopolysaccharide biosynthesis
• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-

Use Curated BLAST to search for 3.6.1.-

Protein Sequence (168 amino acids)

>MPMX19_01945 RNA pyrophosphohydrolase (Azospirillum sp. SherDot2)
MTAPIERPPLDRESLPYRPCVGIMLLNDRGEVFVARRCGSEADWQMPQGGIDEGEDARSA
AFRELEEEIGTAKAEFIAMTAAPHRYDLPDDLLGKVWKGRWRGQEQMWMLARFTGDEADI
RLDTDHPEFDAWKWIDAEELPGLIVAFKRPVYESVLAEFRPLIARAKG