Protein Info for MPMX19_01942 in Azospirillum sp. SherDot2

Annotation: nicotinate-nucleotide adenylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00482: nicotinate (nicotinamide) nucleotide adenylyltransferase
  • amino acids 51 to 235 (185 residues), 127.4 bits, E=3.5e-41
• PF01467: CTP_transf_like
  • amino acids 51 to 230 (180 residues), 64.3 bits, E=6.7e-22

Best Hits

Swiss-Prot: 44% identical to NADD_RHIEC: Probable nicotinate-nucleotide adenylyltransferase (nadD) from Rhizobium etli (strain CFN 42 / ATCC 51251)

KEGG orthology group: K00969, nicotinate-nucleotide adenylyltransferase [EC: 2.7.7.18] (inferred from 92% identity to azl:AZL_023370)

Predicted SEED Role

"Nicotinate-nucleotide adenylyltransferase (EC 2.7.7.18)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation (EC 2.7.7.18)

MetaCyc Pathways

• aspartate superpathway (23/25 steps found)
• NAD de novo biosynthesis I (6/6 steps found)
• NAD de novo biosynthesis III (6/6 steps found)
• NAD salvage pathway II (PNC IV cycle) (5/5 steps found)
• NAD biosynthesis from 2-amino-3-carboxymuconate semialdehyde (4/4 steps found)
• NAD salvage pathway I (PNC VI cycle) (6/7 steps found)
• NAD de novo biosynthesis IV (anaerobic) (5/6 steps found)
• NAD salvage pathway V (PNC V cycle) (4/5 steps found)
• NAD de novo biosynthesis II (from tryptophan) (6/9 steps found)
• superpathway of NAD biosynthesis in eukaryotes (9/14 steps found)
• NAD salvage (plants) (6/11 steps found)

KEGG Metabolic Maps

• Nicotinate and nicotinamide metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.18

Protein Sequence (236 amino acids)

>MPMX19_01942 nicotinate-nucleotide adenylyltransferase (Azospirillum sp. SherDot2)
MARRGLKIDALPTIETLSPRGEGDRYGLTSGFQKDPSLYSGPLYAGLTVGILGGSFNPAH
AGHRHISLFALKALGLDRVWWMVSPQNPLKSTSGMASLPERLAEARAVAAHPGIEVTAIE
TALGTRYTADTLAKLQRRFPKTRFVWLMGADNLRQIPRWKHWNRIFDSVAVAVFARPTYS
LGALSGKAAQRYTRRRVSVSGVKGLARRRRPAWAFLRNPLHPASATAIRQARAAGS