Protein Info for MPMX19_01898 in Azospirillum sp. SherDot2

Annotation: putative glycosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 373 transmembrane" amino acids 265 to 286 (22 residues), see Phobius details amino acids 298 to 323 (26 residues), see Phobius details PF00535: Glycos_transf_2" amino acids 41 to 202 (162 residues), 113.6 bits, see alignment E=4.9e-37

Best Hits

Swiss-Prot: 51% identical to Y501_SYNY3: Uncharacterized glycosyltransferase sll0501 (sll0501) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: None (inferred from 91% identity to azl:AZL_023000)

Predicted SEED Role

"Polymyxin resistance protein ArnC, glycosyl transferase (EC 2.4.-.-)" in subsystem Lipid A-Ara4N pathway ( Polymyxin resistance ) (EC 2.4.-.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.-.-

Use Curated BLAST to search for 2.4.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (373 amino acids)

>MPMX19_01898 putative glycosyltransferase (Azospirillum sp. SherDot2)
MSIPDAPLSAASPDARTVLTRPAAGRPPADRYGRPRRGCLSVVIPFYNEGPNIDALFARL
VPVLDGLGMDWEVVCVNDGSRDDTVDRLLDVHDREPRVKVVDLSRNFGKELALSAGLSHS
TGDAIVPMDADLQHPPELLPAFIAKWREGFDVVVAVRHARVGQSLKHRLFARMFYWVFDH
LSEIKLPREVGDFRLMDRRVVEVINRMPERTRFMKGIFAWVGFRQAAIPYEQGERAGGDT
KWGFVKLLRLSFDGLTAFSTFPLRVWSLVGMAVSGVAFVYILIRLIRTLIHGIDVPGYES
LLVAVLFLGGLQLITLGIIGDYLGRVFAEVKGRPLFIVRSAHGFGPADGRHEHDLDPVGE
SFGDGTAGQEPRR