Protein Info for MPMX19_01824 in Azospirillum sp. SherDot2

Annotation: Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 273 signal peptide" amino acids 1 to 16 (16 residues), see Phobius details transmembrane" amino acids 25 to 44 (20 residues), see Phobius details amino acids 63 to 83 (21 residues), see Phobius details amino acids 102 to 121 (20 residues), see Phobius details amino acids 128 to 149 (22 residues), see Phobius details amino acids 183 to 201 (19 residues), see Phobius details amino acids 213 to 231 (19 residues), see Phobius details amino acids 238 to 264 (27 residues), see Phobius details TIGR00544: prolipoprotein diacylglyceryl transferase" amino acids 8 to 265 (258 residues), 243.4 bits, see alignment E=1.6e-76 PF01790: LGT" amino acids 15 to 264 (250 residues), 255 bits, see alignment E=3e-80

Best Hits

Swiss-Prot: 76% identical to LGT_AZOBR: Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase (lgt) from Azospirillum brasilense

KEGG orthology group: K13292, phosphatidylglycerol:prolipoprotein diacylglycerol transferase [EC: 2.-.-.-] (inferred from 95% identity to azl:AZL_022320)

Predicted SEED Role

"Prolipoprotein diacylglyceryl transferase (EC 2.4.99.-)" (EC 2.4.99.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.-.-.-

Use Curated BLAST to search for 2.-.-.- or 2.4.99.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (273 amino acids)

>MPMX19_01824 Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase (Azospirillum sp. SherDot2)
MLATLPVVAFPTIDPVAFSVGPVVVRWYALAYLAGFVLGWRYCLGLARLDPDRRPNPEEF
DDFLTWAVIGTILGGRLGYVLFYNLPYYLENPLDAVQVWHGGMSFHGGMVGVLTAIALFC
WRRGISPFVFGDIIAACAPIGLFFGRIANFINGELYGRPAPDFAYAMVFPRDPLQVPRHP
SQLYEAALEGVVLFILLAIAIRSPALRNRPGTIGGLFLIGYGLSRITVEFFREPDPQLGF
LFAGATMGQLLSLPMLAIGLWLVLRGRRHAIPA