Protein Info for MPMX19_01819 in Azospirillum sp. SherDot2

Annotation: Holin-like protein CidA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 131 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 28 to 46 (19 residues), see Phobius details amino acids 57 to 77 (21 residues), see Phobius details amino acids 83 to 108 (26 residues), see Phobius details PF03788: LrgA" amino acids 12 to 104 (93 residues), 95.6 bits, see alignment E=7.3e-32

Best Hits

Swiss-Prot: 34% identical to CIDA_BACCN: Holin-like protein CidA (cidA) from Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)

KEGG orthology group: None (inferred from 86% identity to azl:AZL_022280)

Predicted SEED Role

"Antiholin-like protein LrgA" in subsystem Murein hydrolase regulation and cell death

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (131 amino acids)

>MPMX19_01819 Holin-like protein CidA (Azospirillum sp. SherDot2)
MLGTLTLLLLCQLAGELAARLLHLPIPGPVLGMLLLFAGLLLRGGVPNTVQDTAGGLLRH
LSLLFVPAGVGVMVHVTRLETEALPIVAALFGSTLFGIAVTAKLMAFLLSRTDPRLEEEA
AAGEQAKGDRT