Protein Info for MPMX19_01784 in Azospirillum sp. SherDot2

Annotation: Urease accessory protein UreG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00101: urease accessory protein UreG
  • amino acids 15 to 205 (191 residues), 344.5 bits, E=9.6e-108
• PF02492: cobW
  • amino acids 17 to 187 (171 residues), 142.5 bits, E=5.4e-46

Best Hits

Swiss-Prot: 83% identical to UREG_METSB: Urease accessory protein UreG (ureG) from Methylocella silvestris (strain DSM 15510 / CIP 108128 / LMG 27833 / NCIMB 13906 / BL2)

KEGG orthology group: K03189, urease accessory protein (inferred from 98% identity to azl:AZL_021820)

MetaCyc: 67% identical to urease accessory protein GTPase UreG (Helicobacter pylori 26695)

Predicted SEED Role

"Urease accessory protein UreG" in subsystem Urea decomposition

MetaCyc Pathways

• urea degradation II (1/1 steps found)
• superpathway of allantoin degradation in plants (2/8 steps found)

Protein Sequence (214 amino acids)

>MPMX19_01784 Urease accessory protein UreG (Azospirillum sp. SherDot2)
MSALPAIEKSHAGPLRVGIGGPVGSGKTALTDALCKRMREDWEVAAITNDIYTKEDAEFL
TRSGALKPERIMGVETGGCPHTAIREDASINLAAVDQMNAKFPNLDLIFIESGGDNLAAT
FSPELADITIYVIDVSAGDKIPRKGGPGITRSDLLVINKTDLAPMVGASLEVMDRDARKM
RGDRPFVFANVKAGEGVDAIQSFIVQRGGLPLPG