Protein Info for MPMX19_01774 in Azospirillum sp. SherDot2

Annotation: Ketol-acid reductoisomerase (NADP(+))

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 339 PF02826: 2-Hacid_dh_C" amino acids 11 to 104 (94 residues), 28.1 bits, see alignment E=2.6e-10 PF07991: KARI_N" amino acids 14 to 178 (165 residues), 246.1 bits, see alignment E=2.6e-77 TIGR00465: ketol-acid reductoisomerase" amino acids 14 to 327 (314 residues), 448 bits, see alignment E=7.5e-139 PF03807: F420_oxidored" amino acids 18 to 82 (65 residues), 24.6 bits, see alignment E=6.4e-09 PF01450: KARI_C" amino acids 184 to 327 (144 residues), 229.5 bits, see alignment E=3.7e-72

Best Hits

Swiss-Prot: 85% identical to ILVC_RHORT: Ketol-acid reductoisomerase (NADP(+)) (ilvC) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K00053, ketol-acid reductoisomerase [EC: 1.1.1.86] (inferred from 99% identity to azl:AZL_021700)

MetaCyc: 68% identical to acetohydroxyacid isomeroreductase (Cupriavidus necator H16)
Ketol-acid reductoisomerase. [EC: 1.1.1.86]; 1.1.1.86 [EC: 1.1.1.86]

Predicted SEED Role

"Ketol-acid reductoisomerase (EC 1.1.1.86)" in subsystem Branched-Chain Amino Acid Biosynthesis or Coenzyme A Biosynthesis (EC 1.1.1.86)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.86

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (339 amino acids)

>MPMX19_01774 Ketol-acid reductoisomerase (NADP(+)) (Azospirillum sp. SherDot2)
MRVYYDRDADVNLIKGKKVVIVGYGSQGHAHAHNLRDSGVKDVRIALRPGSATIKKAETA
GFTVMTPAEAAAWADVVMVLTPDELQADLYKDDLAPNMKQGAALAFAHGLNIHFNLIEAR
TDLDVFMIAPKGPGHTVRSEYQRGGGVPSLVAVHQNASGNALDIALSYASANGGGRAGII
ETTFKEECETDLFGEQAVLCGGLTELIRAGYETLVEAGYAPEMAYFECLHEVKLIVDLMY
EGGMANMRYSISNTAEYGDYRTGPRIITPETKAEMKRVLTDIQEGRFVRDWMLECKAGQP
SFKAIRRRNAEHEIEKVGEKLRAMMPWIAERRLVDKSKN